Os05t0251400-01

Locus

Os05g0251400

Description

A member of the synaptonemal complex (SC), OmpH/coiled-coil motif-containing protein, Regulation of meiotic double-strand break (DSB) formation and SC assembly, Meiotic recombination

RAP-DB Gene Symbol Synonym(s)

OsBVF1, P31comet

RAP-DB Gene Name Synonym(s)

Bivalent Formation 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

P31comet, OsBVF1, BVF1

Oryzabase Gene Name Synonym(s)

Bivalent Formation 1

Transcript Evidence

AK103883

Protein Evidence

Q6AVD4

Literature

PMID: 28369589

PMID: 27601671

Note

Manual Curation

April 19, 2017

Full-length cDNA

J033150A11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0251400-01)

RiceXPro (AK103883)

Others

Oryzabase (21411)

KEGG (Os05t0251400-01)

Transcript

1115 bp

>Os05t0251400-01 A member of the synaptonemal complex (SC), OmpH/coiled-coil motif-containing protein, Regulation of meiotic double-strand break (DSB) formation and SC assembly, Meiotic recombination
GCGGAAGGATGGAGAGGGCTACCACctccggaggcggcggcggcggcagccagccgccgc
ggggggtagggctgccgttggtggaggtgcaggcggcggcggcgtcgctgcggcggtCGG
AGGTGTTCTACGTCGTGAAGGAGCTCCTCGGCTTCGTCCTCTACATGCACCACCAGATCC
CCGCGGTATTGCAGAATCTTGAAAATGAATTTGCAAGTTTAAAGGAGGAAATGACAGAGA
TGGCATTGCCACCAGGAGAAATGAAACCATCTGATCAGAGAAAGTACAATACACGGAAAA
GGGAAGTAAGACGGAGGATCAAGAAGCAGGAGAAGTTAATGAATGGCCTCTCCAGCGTAT
TTTCTGCTCTTCAGAAAGCACTCGATGAAGTTCCTAGCATTGAAGGAGTTCTCCTGATCC
TCGGTGGTAGCCTTGTCAGGCCTCTGTTTGTCTATGACATTACAATTTCTCATGGTAGAT
TTGATGCTGGAAGTGCCAATGAGCGTGGTGCAAGCAAATTAGCGCAGTCCGTTTCTCGAA
AGGCCATTCGTGCTCTTATATCAAGTGGTGCAGGGAGTTTATCTTATACAGGCCCTACCA
AGCTGTTTGTTCTAGTCAGATGTCCCTGTACATTGAACTTACCACTGGACTTCCTGCCGA
AACGTGATTTTCGTTACAGCAAAAAGGTTGTACCCCTCCAGATGTGTATAAAATGCAATA
TAGCAGGCATCCAAATAGATAATCAACAAATAACATCAATTGTTGATGCTTCAAGATGCA
CTTCAGAATCTACTATTTCTGAGGTTATCTGGTTCCAGTGTAAGCATACGATAAGAGGCC
TACCTTGCAAGGCGTCATTAGAAGAGTGATATGGCCCAAGCATGTTGAAGACGCCCAGAA
AACAGTGGATGATGTAGCGATATAACTCCTGTTCTGACTTTGTAAATGCATACGGCATTC
CGCGAAGGATCATCATTCTGTATGTTCGTTCCATTTGTACAGTGCTATGAAGTTCAGTTC
GCTCCATTGCCTAACAAAGAAGAATGAAAAACAAGAGCACAATTAAAGTTTAGTGAACCT
GAAGTATTGAATTGAATCTCCACACCATTTTACTT

CDS

861 bp

>Os05t0251400-01 A member of the synaptonemal complex (SC), OmpH/coiled-coil motif-containing protein, Regulation of meiotic double-strand break (DSB) formation and SC assembly, Meiotic recombination
ATGGAGAGGGCTACCACctccggaggcggcggcggcggcagccagccgccgcggggggta
gggctgccgttggtggaggtgcaggcggcggcggcgtcgctgcggcggtCGGAGGTGTTC
TACGTCGTGAAGGAGCTCCTCGGCTTCGTCCTCTACATGCACCACCAGATCCCCGCGGTA
TTGCAGAATCTTGAAAATGAATTTGCAAGTTTAAAGGAGGAAATGACAGAGATGGCATTG
CCACCAGGAGAAATGAAACCATCTGATCAGAGAAAGTACAATACACGGAAAAGGGAAGTA
AGACGGAGGATCAAGAAGCAGGAGAAGTTAATGAATGGCCTCTCCAGCGTATTTTCTGCT
CTTCAGAAAGCACTCGATGAAGTTCCTAGCATTGAAGGAGTTCTCCTGATCCTCGGTGGT
AGCCTTGTCAGGCCTCTGTTTGTCTATGACATTACAATTTCTCATGGTAGATTTGATGCT
GGAAGTGCCAATGAGCGTGGTGCAAGCAAATTAGCGCAGTCCGTTTCTCGAAAGGCCATT
CGTGCTCTTATATCAAGTGGTGCAGGGAGTTTATCTTATACAGGCCCTACCAAGCTGTTT
GTTCTAGTCAGATGTCCCTGTACATTGAACTTACCACTGGACTTCCTGCCGAAACGTGAT
TTTCGTTACAGCAAAAAGGTTGTACCCCTCCAGATGTGTATAAAATGCAATATAGCAGGC
ATCCAAATAGATAATCAACAAATAACATCAATTGTTGATGCTTCAAGATGCACTTCAGAA
TCTACTATTTCTGAGGTTATCTGGTTCCAGTGTAAGCATACGATAAGAGGCCTACCTTGC
AAGGCGTCATTAGAAGAGTGA

Protein

287 aa

>Os05t0251400-01 A member of the synaptonemal complex (SC), OmpH/coiled-coil motif-containing protein, Regulation of meiotic double-strand break (DSB) formation and SC assembly, Meiotic recombination
MERATTSGGGGGGSQPPRGVGLPLVEVQAAAASLRRSEVFYVVKELLGFVLYMHHQIPAV
LQNLENEFASLKEEMTEMALPPGEMKPSDQRKYNTRKREVRRRIKKQEKLMNGLSSVFSA
LQKALDEVPSIEGVLLILGGSLVRPLFVYDITISHGRFDAGSANERGASKLAQSVSRKAI
RALISSGAGSLSYTGPTKLFVLVRCPCTLNLPLDFLPKRDFRYSKKVVPLQMCIKCNIAG
IQIDNQQITSIVDASRCTSESTISEVIWFQCKHTIRGLPCKASLEE*

5'UTR

chr05:9188371..9188378 (+ strand) : 8 bp

CDS

chr05:9188379..9188554 (+ strand) : 176 bp

chr05:9189926..9189974 (+ strand) : 49 bp

chr05:9190064..9190372 (+ strand) : 309 bp

chr05:9190755..9190803 (+ strand) : 49 bp

chr05:9191116..9191210 (+ strand) : 95 bp

chr05:9191317..9191441 (+ strand) : 125 bp

chr05:9192087..9192144 (+ strand) : 58 bp

3'UTR

chr05:9192145..9192390 (+ strand) : 246 bp

FASTA

>Os05t0251400-01 class=Sequence position=chr05:9188371..9192390 (+ strand)
GCGGAAGGAT GGAGAGGGCT ACCACctccg gaggcggcgg cggcggcagc cagccgccgc ggggggtagg gctgccgttg
gtggaggtgc aggcggcggc ggcgtcgctg cggcggtCGG AGGTGTTCTA CGTCGTGAAG GAGCTCCTCG GCTTCGTCCT
CTACATGCAC CACCAGATCC CCGCGTAATC CCCCCTCGAT CCGCTCCCAT CCTATCCCCC CGCCCTTCTC TCTTTCAATC
TCTCTCCCTC TCCCAAATGC TGGGGAAGTG GTCGGTATAG GGATGGATTT GGTGGGTCTC TATGTGAGTT TTTAGCATCT
AGGTTACAGT CTAAACAATT TGTTCGAGTT CGAATCTAAT TTTCTAGAGC AATTGAGGTG GTACTGAACT TCGGATTTGG
TCACCAGATT TTGATGGGTT TTGTTCTAGC AACCTTAGTG CTTGTGGATC TAATTGGGAT ACAAGTTGCA TTGCATCAAT
CCATCAAATA GGCAATGGCC TGACTGAATG GCTGTTCTGC TGTAGCAGAG TTGAGAATTC CATTAATTCA AAATGGCTCT
AGAAATATGC GTGGCGTTCT GGACCATACT GTTGGCAATG AATTGGGCAA CTTCATCGAT GATGATTTGA AGGTTCACTT
TTGTAACAAA TTGCTTGCAT TTCCTTTGCT TCCTGGGAGA TGTTTGGTAT TGATATGTGG CCTTAGGTTG TGCATTCTCT
GTTAGATGAA TATGACTGTT GATTGTTATG TTATTATAAA CTGTTAATTT GACGAGATAC TTTAATTTAC CTTATTGTAG
CGTGTTATCT ACTCCTGGTC CTGATTACAT GTGTTGGTGC AGGTGTGGTG TTCTTGTGCT TTCGTTCTTA TGTTTTATGC
ACATAATAAA ATAGACAAAA AAAAATTCTG GAAGAAATCA AAGTGTGTGT ATCCGTTCTT GTAGAAATTT CTGCTGTACG
ACTTTTTTCC CCCGCAaata tgccaaaaaa cttgcatata tttgtattaa gaagaataaa tagtaagaga acaaagtagc
aacaaatATA CATACACACA CAGAGCTTCA AAAGAACAAA TGGTCAGAGA CTTTATGTAT GACTGTTTAG TTTCTGTGTA
TGTTCTGGGC TCTGGTTCTT CATTTGCAAT ACCTGAGCAC ATACTCATGA CCAACCTAGT TTGTCCAGTA CAACAGAATA
ATGTTGATGC ATTGGTGTGA CGCTGTTATT CTATGATGTA GGGCTAATTT TCTGGGGCTT AAGTTAGGCA CACAGCATTG
TTGTGCATTG GTGCTTGACT TCTAGGATGC GTACATCACT GAAGATGAAA CCTTTGAAGA TGAAATCTCC TGCTATTGTG
TTGTTTAAAT TTGTTATAGC ACACCTGCAC TGCAATCAAA GAAAAAGAAT ATAAGTGAAC AGCATTTAGC TTGGATTATG
TAATTATCCA TTTTGCAGAT GGCCAGATTA TATACTAAGT TAGGGCAGTT ATACACTGCT GTATGTAAAA TTATCACATG
AATTTGAAGT CTAATTTGTT TTTCTACATT TTCAGGGTAT TGCAGAATCT TGAAAATGAA TTTGCAAGTT TAAAGGAGGA
AATGGTAAGT TTTGTTCTCA GAAAGAATGT CACCATTAGC ATCTACGCAG TATTTCTTTA TCGAGCCTAT TAATAATTTG
TGGCTATTTA TAGACAGAGA TGGCATTGCC ACCAGGAGAA ATGAAACCAT CTGATCAGAG AAAGTACAAT ACACGGAAAA
GGGAAGTAAG ACGGAGGATC AAGAAGCAGG AGAAGTTAAT GAATGGCCTC TCCAGCGTAT TTTCTGCTCT TCAGAAAGCA
CTCGATGAAG TTCCTAGCAT TGAAGGAGTT CTCCTGATCC TCGGTGGTAG CCTTGTCAGG CCTCTGTTTG TCTATGACAT
TACAATTTCT CATGGTAGAT TTGATGCTGG AAGTGCCAAT GAGCGTGGTG CAAGCAAATT AGCGCAGTCC GTTTCTCGAA
AGGTGAGCTA CTTTCTGGCT TAATGCTCCA TGAATAACTA TCACCCATTA GATCCTAGGG TGACTACATT TCTTTAGAAT
TTGGTAGTTT TTCTGAAGTA CCATAGAGTT GAGATCTGAA CGTTGATGGA ATTCACAATG CTGTAACTTT TAGTACCTAC
TTTGGACAAC AATATGGCAA TAGCATATCT GAAATGTTCT AGTGTTGTAG TTTTGCTCTA CTGTTTGGCA TTTTGGCATA
TGACCAAACA GTGTAAGGAG AATCTTGCTA TGTTTTTGCC CCATTGCTAG GCTTAATTCT ATTTTTTTTT ACTTATCATT
GTGCATGTTT CATCTTCATA TGGTGGTCCT CTTTAAATAA TAACATGCAT ATGTATATGT ATAGGCCATT CGTGCTCTTA
TATCAAGTGG TGCAGGGAGT TTATCTTATA CAGGTACTGG TTCTTCTGTT TTACTATAta ctagctctgt tccaaaatat
aagaattttt agtggtggac atgggtatta aggaagtagg tggaattaaa tgggagaagg ttgtgattgt ttgagaagtg
aaaatatgtg aagaaattaa atgtggggag attgtgatta gttgataaga gaatgtaagt agagaagttg tattttggga
caaaatttga atgctgaaat tgttatattt tgggacagtg ggggtaTTTG ATTGGGAATG CCATCATCCT TTTACCTTAA
CGTTTTCCCT CCAATTGTTT TGAAGGCCCT ACCAAGCTGT TTGTTCTAGT CAGATGTCCC TGTACATTGA ACTTACCACT
GGACTTCCTG CCGAAACGTG ATTTTCGTTA CAGCAAAAAG GTTTTTTTTT TTTCTGAAGT TAGTTTATGT TTTTTGTCAG
CTTCCTTTTG CAAAAAGATC TAATGTCTCC CTGATTAATA CATGAGCCTT AATCTTTTCA ACACAGGTTG TACCCCTCCA
GATGTGTATA AAATGCAATA TAGCAGGCAT CCAAATAGAT AATCAACAAA TAACATCAAT TGTTGATGCT TCAAGATGCA
CTTCAGAATC TACTATTTCT GAGGTTATCT GGTAAATAAT TCTGGTCATC TGTTCCCAGT TACCCATTTA TCACTATTTG
CTTTCTGCTG CTATTTCCCC TCCTGTGTAA TGGTAACCAA TAGTTCAGTA TTGTCTTAAG TACGGCAAAC CTTCCCTAGT
ACTATGCAAG ATAGAGTGCT CTTCCTGAGT CCATGCCACT TTATTTTCTT AAAATCAAGG CAGGAGCACT GCTGAATTCT
ACTAGAAGAG GTGAAATTAT GATTACAAGA AGCCCATTAG TGTAATCTTA TTAAACTGCA TATGAATCTT TTGTGTTTTG
AAGGATAAAA GAAATTTAAT TTACCAACAT TTGAATTATG TGCTTTTGTG TTTTGTTGGC ATCAAGTATT GCAAAGAATT
ATTTTAAGGT TGATACGGTT AGGATTTTTT CTCAGAAATC TTACCCATTT TAGTTTGTTA TGTGTACACT GGTTTCCTTC
TATTTTTTCC CCTGAAAAAC ATGTATGTGT TTTGATGACC cctgttctgt ttttagacct ttgaacttcc ccctttttca
gtctattagg cagagctcct gccattttcg ttaaaaaaaG AAAAGAGTGA TCTCCAGCGG ATCTTTTCTT TTGAACTTAA
GTAAATTCAG TTAACGAATA TTCATTAATT TTCCAGGTTC CAGTGTAAGC ATACGATAAG AGGCCTACCT TGCAAGGCGT
CATTAGAAGA GTGATATGGC CCAAGCATGT TGAAGACGCC CAGAAAACAG TGGATGATGT AGCGATATAA CTCCTGTTCT
GACTTTGTAA ATGCATACGG CATTCCGCGA AGGATCATCA TTCTGTATGT TCGTTCCATT TGTACAGTGC TATGAAGTTC
AGTTCGCTCC ATTGCCTAAC AAAGAAGAAT GAAAAACAAG AGCACAATTA AAGTTTAGTG AACCTGAAGT ATTGAATTGA
ATCTCCACAC CATTTTACTT 

Locus: Os05g0251400

Loading...

Locus: Os05g0251400

Loading...