Os05t0279400-01

Locus

Os05g0279400

Description

RING-type E3 ubiquitin ligase, Control of innate immunity and broad-spectrum disease resistance

RAP-DB Gene Symbol Synonym(s)

EBR1

RAP-DB Gene Name Synonym(s)

enhanced blight and blast resistance 1

CGSNL Gene Symbol

EBR1

CGSNL Gene Name

ENHANCED BLIGHT AND BLAST RESISTANCE 1

Oryzabase Gene Symbol Synonym(s)

OsRFP

Oryzabase Gene Name Synonym(s)

RING finger protein, enhanced blight and blast resistance 1

Transcript Evidence

AK102650

Protein Evidence

Q0DJH5

Literature

PMID: 27978435

Note

Manual Curation

December 23, 2019

Gene Ontology (GO)

Molecular Function: nucleic acid binding (GO:0003676)

Functional domain (InterPro)

Zinc finger, RING-type (IPR001841)

ZN598/Hel2, RING finger (IPR041888)

Zinc finger C2H2-type (IPR013087)

Full-length cDNA

J033101B01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0279400-01)

RiceXPro (AK102650)

Others

Oryzabase (21173)

KEGG (Os05t0279400-01)

Transcript

3310 bp

>Os05t0279400-01 RING-type E3 ubiquitin ligase, Control of innate immunity and broad-spectrum disease resistance
GCCGTGCGGGCCGCCAACACAAGGACGCGACGACAAGGGTGGGGGGATAAGCGGAGAGAG
AGAGAAAAAGGAAAAACTGTCTCGTCGTCTCGAACCTTCTCGCCTCCCTCACCGCCCTAA
CCCTTCCTCTTCTCCTCCGCCGCCGCCACCGCCGCTCCGCCCCCTCCGTCCCTTCGCCGC
TACCGATCTCCCCCGCCCGCCCGCGGAGATGGACGACAGCTGCGCGGTGTGCGCGGACGC
GCTGGAGTGGGTGGCCTACGGGGCCTGCGGCCACCGCGAGGTTTGCTCGACCTGCGTCGT
TCGCCTCCGCTTCGTGATGGGCGACAAGCACTGCTGCATCTGCAAGACCGAGTGCTCCTC
CGTATTCGTCACCAAGGCTATGGGCGATTACACAAAAGTGATAAATGATTTCAATATTTT
CCCCCCTGTGGCAACTGAGGGAAAGGTGGGGGAGTACTGGTACCATGAGGATAGCCAGGC
ATTTTTTGACGATGCTGAGCACTACAAGATGATACGAGCAATGTGTCGGCTTTCTTGTAG
TGTGTGTGACAAAGCTGAAGATCAGGCTGGCCAGGCAGCACAAGTAAGGCGCAAAAGCAA
GTTCAGGAGCATTGAACAGCTGAAGGGACATTTGTTCCATCAACATAGGTTATACATGTG
CAGTCTTTGCTTGGAGGGGAGAAAGGTGTTCATTTGTGAACAGAAGCTTTATACAAGGAC
ACAGTTAAATCAGCATGTAAAAACTGGTGACTCTGAGGTGGATGGCTCTGAGGTTGAGCG
CAGTGGTTTTGCAGGACATCCTATGTGCGAGTTCTGCAGAAGTTCATTTTATGGAGATAA
CGAGCTTTACACACATATGTCCCGAGAACACTATTCATGTCACATATGTCAAAGGCAACA
TCCTGGGCAGTATGATTATTTCCGGAATTATGATGACTTGGAGTTGCATTTCCGTAAAGA
TCATTTCCTCTGTGAAGATGAAGCATGTTTGGCGAAGAAGTTTGTAGTCTTCCAGAGCGA
AGCAGAGCTCAAGAGACATAATGCTATGGAGCATGGTGGGCGGATGTCTCGTGCTCAGAG
GAATGCCGCACTTCAGATACCAACCAGCTTTATATATCGAAGAAACGAGCAAGATGAAAG
GCGTGGTAGAGGTAGGGGACGGAATTCTCACCGTGATGGATCTGACCGGGATACCCCCTC
TATGCAAAATGGCAGTGCAATTATAGGCAACGGTTTTCCAAGTCGAGTTGATAATGTTAC
AGGGTCTGTGAGTGTCAGTTCTAGTTCTGGGCGAGGAGAATCTGGCCAAAGCTCAGGCAA
TGGACGTGTGTTTGAACACTTGTCCTTTCCTCCTCTTCAAGACCAGGATATTCCTGATGC
AAGGATGGACTCTGCTCCTGATGAAACCTCATTCCCTTCCCTCTCAGAGCAGCAAACCAG
ATATGCTCATGCTCTTAGTCAGAGTTCCCTTGCTGCCAAGCTTGGGGATGAGTTATTATT
CCCTCCACTACCTGGGTCAAGTAGCAACAGGGGTTCTACTTCAACTCAACAGGGGCTACA
AAGTCTAGCGAAGAACACACTTGCATCAAGGCTTCAGCAGCGTAGCAAGGGCAGTGTGAA
AGTACTTCATTCTGCCCGGCCTCGCCCATCTGAAAATCCTGAATCAGTCCCTCCTGTTTC
TAGTTCCCCACAGATGTGGCCTACACCTGATCAGGGGCTGCTTCATTCTAGTTCTTCCCA
GCTTCGAATTGTAAGAGAAAATGGGATTATGTCATCTGCCGACTCGGCATGGAATCCTGG
AGGTGGAGCTTCAAACAGGATGAAGCACTCTGTTTCTACTCCTAATCTTATGTCTGGTGG
GTCCTCTGTTCAGGCACTAAGTACATCTAACGGTGGCAATAAAAAACAACAGCCACCACA
AAGCAGCCAAACATTGCCTGCTGCTGATGATGTTCGTGCTGCCAATAAGACCCTGGTTGA
AAGAATGCGCAGTGCTTTAGGCATGGATGAAGATAGGTACTCTGCATTTAAAGAAATCGC
TGGTGAATACCGTCAAGGCATCATTGGTACTTCAGAATATCTTTCATATGTTGAGCAATT
TGGTCTGTCACACCTTGTGCCTGAAATGGCTAGGCTGTTACCTGATCCTCAGAAGCAGAA
AGAACTTGCTGATGCCTATCACACCAATATACGCTTCAGAAGCCTCCAAGAGAACAGTGA
TGGTTTAACCATTACCTCAAAGGAGGGTGGCCGCAAGAAAAAGGGCAAGGGAAAATCTCA
TGATGTTACAGAAACTAGTGCTGCTCCTGCTAAGGATATGAAGGATTCACTAGCAGATAG
CTTCCTGGACACTGTAAGGAAGCTTCAGTTAAACAAGACTCAGGAAGGAGAGGCTGAGGT
GCTGTCAAGGGATGGGTATCGATCTTCCAAGGGAAAGGCCCAACTAATAACTGGAGGTTC
ATCATCTAGTACACCATGTCTAGATGGTGATCATGGTGCCATTTCAATGGCTTCTTGTGC
CAAAGATGATGTAGGCAAGGGAGGAGGTAGCAGCAACAGCAACATCAACAAACAATCAAA
GAAGACATCAAAGTTTCTCAGAGCCCGATTAGGTGATAACTCCTTAGCTACACTTGATTT
GAGTCGTCCTACCATGAGCCCTGAACGACCAGAAAGGGAATCGCAAGGCCCACAGGTAGG
GTTGCCTATGCGAGGTGTTTGGAAAAATGGAGGGGGCCAGAAGCTCTTTACGGGCAATGG
AAGGAAGTAAAATCATTTTGCAGATGCAGTTTGACTTTTGAAACGAGCTGGTCAATGGTA
CAAGCAGATTCTGTTGCCAAGTGTGCATATTTTGTGATCAGTTGGTTAGCTGGTCGTGGG
AGAGCTTTATTGCTCCTTTGAAGATCATCGCCTTTGAATTACACCTCACTTTCTTGTTTT
CTTTGCCAAAACATCAACTGAGGCTGAAACTTGAAACAGTAATGGCGTGATATTACGTTA
CTGGCCAGTTAGTGGAATCCATTGGTAGATGGTATTTTACATGAGCTCTGCCAAATATTA
TAGTTACTTTATCACTTTGTTTGTGCTGGATTGCAGTCAAAGACATGTATTTAGTGTGTC
TGTGATCAGGCCGACCCTAACTGAATTCGTGAAAGTTGAAATCTCAATGTTCTTCGTGTT
ATTTAAACGGAATTGCTAGAAAACTCTTTCGTAAGTTTTTTGCTCCCAAAACTTTTAGAT
TTGTGACCATAGGATCACCTTGAGATTTGTGCATGAAGGGGGAAAAATACTATAAAGAAA
ATTTCACAGT

CDS

2562 bp

>Os05t0279400-01 RING-type E3 ubiquitin ligase, Control of innate immunity and broad-spectrum disease resistance
ATGGACGACAGCTGCGCGGTGTGCGCGGACGCGCTGGAGTGGGTGGCCTACGGGGCCTGC
GGCCACCGCGAGGTTTGCTCGACCTGCGTCGTTCGCCTCCGCTTCGTGATGGGCGACAAG
CACTGCTGCATCTGCAAGACCGAGTGCTCCTCCGTATTCGTCACCAAGGCTATGGGCGAT
TACACAAAAGTGATAAATGATTTCAATATTTTCCCCCCTGTGGCAACTGAGGGAAAGGTG
GGGGAGTACTGGTACCATGAGGATAGCCAGGCATTTTTTGACGATGCTGAGCACTACAAG
ATGATACGAGCAATGTGTCGGCTTTCTTGTAGTGTGTGTGACAAAGCTGAAGATCAGGCT
GGCCAGGCAGCACAAGTAAGGCGCAAAAGCAAGTTCAGGAGCATTGAACAGCTGAAGGGA
CATTTGTTCCATCAACATAGGTTATACATGTGCAGTCTTTGCTTGGAGGGGAGAAAGGTG
TTCATTTGTGAACAGAAGCTTTATACAAGGACACAGTTAAATCAGCATGTAAAAACTGGT
GACTCTGAGGTGGATGGCTCTGAGGTTGAGCGCAGTGGTTTTGCAGGACATCCTATGTGC
GAGTTCTGCAGAAGTTCATTTTATGGAGATAACGAGCTTTACACACATATGTCCCGAGAA
CACTATTCATGTCACATATGTCAAAGGCAACATCCTGGGCAGTATGATTATTTCCGGAAT
TATGATGACTTGGAGTTGCATTTCCGTAAAGATCATTTCCTCTGTGAAGATGAAGCATGT
TTGGCGAAGAAGTTTGTAGTCTTCCAGAGCGAAGCAGAGCTCAAGAGACATAATGCTATG
GAGCATGGTGGGCGGATGTCTCGTGCTCAGAGGAATGCCGCACTTCAGATACCAACCAGC
TTTATATATCGAAGAAACGAGCAAGATGAAAGGCGTGGTAGAGGTAGGGGACGGAATTCT
CACCGTGATGGATCTGACCGGGATACCCCCTCTATGCAAAATGGCAGTGCAATTATAGGC
AACGGTTTTCCAAGTCGAGTTGATAATGTTACAGGGTCTGTGAGTGTCAGTTCTAGTTCT
GGGCGAGGAGAATCTGGCCAAAGCTCAGGCAATGGACGTGTGTTTGAACACTTGTCCTTT
CCTCCTCTTCAAGACCAGGATATTCCTGATGCAAGGATGGACTCTGCTCCTGATGAAACC
TCATTCCCTTCCCTCTCAGAGCAGCAAACCAGATATGCTCATGCTCTTAGTCAGAGTTCC
CTTGCTGCCAAGCTTGGGGATGAGTTATTATTCCCTCCACTACCTGGGTCAAGTAGCAAC
AGGGGTTCTACTTCAACTCAACAGGGGCTACAAAGTCTAGCGAAGAACACACTTGCATCA
AGGCTTCAGCAGCGTAGCAAGGGCAGTGTGAAAGTACTTCATTCTGCCCGGCCTCGCCCA
TCTGAAAATCCTGAATCAGTCCCTCCTGTTTCTAGTTCCCCACAGATGTGGCCTACACCT
GATCAGGGGCTGCTTCATTCTAGTTCTTCCCAGCTTCGAATTGTAAGAGAAAATGGGATT
ATGTCATCTGCCGACTCGGCATGGAATCCTGGAGGTGGAGCTTCAAACAGGATGAAGCAC
TCTGTTTCTACTCCTAATCTTATGTCTGGTGGGTCCTCTGTTCAGGCACTAAGTACATCT
AACGGTGGCAATAAAAAACAACAGCCACCACAAAGCAGCCAAACATTGCCTGCTGCTGAT
GATGTTCGTGCTGCCAATAAGACCCTGGTTGAAAGAATGCGCAGTGCTTTAGGCATGGAT
GAAGATAGGTACTCTGCATTTAAAGAAATCGCTGGTGAATACCGTCAAGGCATCATTGGT
ACTTCAGAATATCTTTCATATGTTGAGCAATTTGGTCTGTCACACCTTGTGCCTGAAATG
GCTAGGCTGTTACCTGATCCTCAGAAGCAGAAAGAACTTGCTGATGCCTATCACACCAAT
ATACGCTTCAGAAGCCTCCAAGAGAACAGTGATGGTTTAACCATTACCTCAAAGGAGGGT
GGCCGCAAGAAAAAGGGCAAGGGAAAATCTCATGATGTTACAGAAACTAGTGCTGCTCCT
GCTAAGGATATGAAGGATTCACTAGCAGATAGCTTCCTGGACACTGTAAGGAAGCTTCAG
TTAAACAAGACTCAGGAAGGAGAGGCTGAGGTGCTGTCAAGGGATGGGTATCGATCTTCC
AAGGGAAAGGCCCAACTAATAACTGGAGGTTCATCATCTAGTACACCATGTCTAGATGGT
GATCATGGTGCCATTTCAATGGCTTCTTGTGCCAAAGATGATGTAGGCAAGGGAGGAGGT
AGCAGCAACAGCAACATCAACAAACAATCAAAGAAGACATCAAAGTTTCTCAGAGCCCGA
TTAGGTGATAACTCCTTAGCTACACTTGATTTGAGTCGTCCTACCATGAGCCCTGAACGA
CCAGAAAGGGAATCGCAAGGCCCACAGGTAGGGTTGCCTATGCGAGGTGTTTGGAAAAAT
GGAGGGGGCCAGAAGCTCTTTACGGGCAATGGAAGGAAGTAA

Protein

854 aa

>Os05t0279400-01 RING-type E3 ubiquitin ligase, Control of innate immunity and broad-spectrum disease resistance
MDDSCAVCADALEWVAYGACGHREVCSTCVVRLRFVMGDKHCCICKTECSSVFVTKAMGD
YTKVINDFNIFPPVATEGKVGEYWYHEDSQAFFDDAEHYKMIRAMCRLSCSVCDKAEDQA
GQAAQVRRKSKFRSIEQLKGHLFHQHRLYMCSLCLEGRKVFICEQKLYTRTQLNQHVKTG
DSEVDGSEVERSGFAGHPMCEFCRSSFYGDNELYTHMSREHYSCHICQRQHPGQYDYFRN
YDDLELHFRKDHFLCEDEACLAKKFVVFQSEAELKRHNAMEHGGRMSRAQRNAALQIPTS
FIYRRNEQDERRGRGRGRNSHRDGSDRDTPSMQNGSAIIGNGFPSRVDNVTGSVSVSSSS
GRGESGQSSGNGRVFEHLSFPPLQDQDIPDARMDSAPDETSFPSLSEQQTRYAHALSQSS
LAAKLGDELLFPPLPGSSSNRGSTSTQQGLQSLAKNTLASRLQQRSKGSVKVLHSARPRP
SENPESVPPVSSSPQMWPTPDQGLLHSSSSQLRIVRENGIMSSADSAWNPGGGASNRMKH
SVSTPNLMSGGSSVQALSTSNGGNKKQQPPQSSQTLPAADDVRAANKTLVERMRSALGMD
EDRYSAFKEIAGEYRQGIIGTSEYLSYVEQFGLSHLVPEMARLLPDPQKQKELADAYHTN
IRFRSLQENSDGLTITSKEGGRKKKGKGKSHDVTETSAAPAKDMKDSLADSFLDTVRKLQ
LNKTQEGEAEVLSRDGYRSSKGKAQLITGGSSSSTPCLDGDHGAISMASCAKDDVGKGGG
SSNSNINKQSKKTSKFLRARLGDNSLATLDLSRPTMSPERPERESQGPQVGLPMRGVWKN
GGGQKLFTGNGRK*

5'UTR

chr05:11660556..11660763 (+ strand) : 208 bp

CDS

chr05:11660764..11660931 (+ strand) : 168 bp

chr05:11661735..11662043 (+ strand) : 309 bp

chr05:11663328..11663536 (+ strand) : 209 bp

chr05:11663623..11663671 (+ strand) : 49 bp

chr05:11663787..11663874 (+ strand) : 88 bp

chr05:11663971..11664035 (+ strand) : 65 bp

chr05:11664161..11665834 (+ strand) : 1674 bp

3'UTR

chr05:11665835..11666374 (+ strand) : 540 bp

FASTA

>Os05t0279400-01 class=Sequence position=chr05:11660556..11666374 (+ strand)
GCCGTGCGGG CCGCCAACAC AAGGACGCGA CGACAAGGGT GGGGGGATAA GCGGAGAGAG AGAGAAAAAG GAAAAACTGT
CTCGTCGTCT CGAACCTTCT CGCCTCCCTC ACCGCCCTAA CCCTTCCTCT TCTCCTCCGC CGCCGCCACC GCCGCTCCGC
CCCCTCCGTC CCTTCGCCGC TACCGATCTC CCCCGCCCGC CCGCGGAGAT GGACGACAGC TGCGCGGTGT GCGCGGACGC
GCTGGAGTGG GTGGCCTACG GGGCCTGCGG CCACCGCGAG GTTTGCTCGA CCTGCGTCGT TCGCCTCCGC TTCGTGATGG
GCGACAAGCA CTGCTGCATC TGCAAGACCG AGTGCTCCTC CGTATTCGTC ACCAAGGTTC GTATCGTCGC TAGGGTTTCC
TCCGCCCCGG CCAGGTTGTT TGATCTGTGC CGTCGGGAGC GTCGGTGGAT CTTGGGTCGT CGGCTGGTTA GGGTTTCGAT
GGGCTTGAAA TATGGGGCTC TTGCTCGTGA AATTGTATGG TTTTATGGTG GTGAAAATTT GTTCGATTTC ACGAACTAAT
GTTGTTGGCT AATTATGTGA ACTTAGCTTA TTGTATGAAT TGGTTCCTAG GGAGTTGGGA TTTCAGCTAA AAACCTAATG
CTACTGAGAA GAAGACAATG AGTTTAATCA GCACAAATTT ATTTAATCAG AAATTTGTTT TGTCAAGCGA TTAGGGGTCG
GCAATTTGAG TTCAGGTGTT AATAATGGGA TGCCATGGTT CCTGTACTTC CTTTTTTGAT ACATGGCATT GCAAGCTACT
ATTATTCTTA CACTTAGTGT GACCGATTAT GATATTTAGG CTTATGACTG AGCTAGAAAT TTTTTTATCG AGCTTTATTA
ATGTGAGTTT GTTAGGCTTC CCTATCTGAG TTATCAGCAT TTTTTCTGTT GTGTTTTATT AGTGCAAAGA CAAGCAGAAA
AAAAATGTGC AAGTGTTCCT TTAATGTTTT ATGTTTTCAC TATGAATTTC CTTTGCTATT TAATCGATGG CTGATTGTGT
AACTCATTGG TTACTTTCTC TGTTTTTTTT TATAATAAAA TTAGACTGAA GTCATTGTAT AGCTAAAGGA TTGCATGTGC
AGTCTTCATA TGAATTTAAA ATTTTAATTA TGGCTCATTC ATCTTTGATC ATTCAACAGG CTATGGGCGA TTACACAAAA
GTGATAAATG ATTTCAATAT TTTCCCCCCT GTGGCAACTG AGGGAAAGGT GGGGGAGTAC TGGTACCATG AGGATAGCCA
GGCATTTTTT GACGATGCTG AGCACTACAA GATGATACGA GCAATGTGTC GGCTTTCTTG TAGTGTGTGT GACAAAGCTG
AAGATCAGGC TGGCCAGGCA GCACAAGTAA GGCGCAAAAG CAAGTTCAGG AGCATTGAAC AGCTGAAGGG ACATTTGTTC
CATCAACATA GGTTATACAT GTGCAGTCTT TGCTTGGAGG GGAGAAAGGT GACATTCTTG ACAACAATGT GCTCTTTTCT
CCTTAAATAG TCACTGTTGG TTTGATTGTT TCCTGCATTT TAAAAATAAA ATCAGCATGA AGTCTTAAGA GACTGTCATG
GGGAATGATC TAGCTACTTA TGTGGACATG CTTTGCTCAT TGTGTGAGCC TAGtaggtac tacctctgtc cctaaataag
tgcacttcta gcacccaaat tttataccaa aataagtgca cccctagagt aagcttatcc catccatcac ttcccattca
attttctacc tattttaccc ccaactaccc tcccacttct aaccatgact catttaattg ggggcttata tgtcatttat
cttcctagtg atttgtctgc catgtgctaa atgcacttat ttaggatgat ggtagtaGTA ATTAAGTAAT CTTGACTATT
GTTGATATCA CTGCTTTTAC TATGTATGCC ATATGTAAAT ATGTAAAAGA TCGGAGAAAT CTATAAGTAC TTGGTGAAAG
ATCTTTTGCT TTCCATAAAG TGTTGCTTTT GCTTTGTGTG ATGAGTTGAC TTTTTTTGGG GGGAAATGGA ATTGAAATTC
TTGCAAACTA AAGAAATTGA AGCAGAGATA CTTTCTCATG AGGATGGTAA CATTTAGAGT AGTTAGTCTA TGTTTAATTG
TGGCTACATG CTACATAGCC CAGTGCCAGT TCCCCATCGT CACAGTTACT GCATATTCTC ATTGCTTTAA AATGTAATGT
GCTTATGGAA TTGTATGCAT GACCTCATAG ACTGGTGGCC AGCTTTTGTC AACTCGGCTA GTCCACCAGG GTGCTGACCG
ATCTCAGTGG TGTCTAGGTT GTGCTCGGAA CTGATTTCTT GAATACTGGT CCAATGCAAA CCATTCCACT TGAGCATTTT
TTATCTGTAT GAATAATTTG GTTTACTAAC CTAGAAGTAT TTAATTAAAA CCAATTTATA TCAGTTATGT TGGATACAGT
ATTAATGTAG TAATATAATA TTGGGGACAC AGACCATGCT ATTTGAAGTG AAAGTAACTG AAGCTGATGT CTGTATGTTT
GAAGCTGAGA TTGATTTTGT AATGTGCATT TTCAACCCAC TGGGAAGGTA GAAATGAAAA GCTTTACGTT AACACCCTCC
AACTATAATA AATTATCTAT TTTGCCCACA CGCATATTGT TATCTTGATA ACATAGGGGC TATTTTACTA CACTTTTAAC
TAACTGAGAC TTGATGGTAG TTTGTTTGAC TAGTTGATGT GTTGTTGGCC AGGTGTTCAT TTGTGAACAG AAGCTTTATA
CAAGGACACA GTTAAATCAG CATGTAAAAA CTGGTGACTC TGAGGTGGAT GGCTCTGAGG TTGAGCGCAG TGGTTTTGCA
GGACATCCTA TGTGCGAGTT CTGCAGAAGT TCATTTTATG GAGATAACGA GCTTTACACA CATATGTCCC GAGAACACTA
TTCATGTCAC ATATGTCAAA GGTATCATCA TGTACCTCAT TACCCTTAGC TAAATTGTAC TAACACGCTA TGTGATATTC
TAACTTACGA TTGGTCATTG GTTGCAGGCA ACATCCTGGG CAGTATGATT ATTTCCGGAA TTATGATGAC TTGGAGGTTT
GTTGGCACAA ATGGATATGT TGCCTTTGTT CGAAGATGTT TTTTTTTTCA TTTACTCTGT TCTGCAAGCT TTTGGTAGCA
TCCTAATGTA TGTTTTATTA ATTCAATTCA GTTGCATTTC CGTAAAGATC ATTTCCTCTG TGAAGATGAA GCATGTTTGG
CGAAGAAGTT TGTAGTCTTC CAGAGCGAAG CAGAGCTCAA GGCAAGTATA TTTCAGTTAG TTGTATTAGC TGCTCTGTTA
CTGCATTAGA TGCTAGGTTA CTTATTTTCA TATTTCTTGG CTTGTTTATT TCTCCAGAGA CATAATGCTA TGGAGCATGG
TGGGCGGATG TCTCGTGCTC AGAGGAATGC CGCACTTCAG GTATGTATTA GTCTTAGAAT TTCTCATTCT TGTGCCTAAG
GTTTCCCTTT TATCCTGCTC ACCTGTCTTG TTTGTACTAA TACTGGAATT TTCTTTGAGC TAATTTTTCT GTTTGGCTTT
GTCAGATACC AACCAGCTTT ATATATCGAA GAAACGAGCA AGATGAAAGG CGTGGTAGAG GTAGGGGACG GAATTCTCAC
CGTGATGGAT CTGACCGGGA TACCCCCTCT ATGCAAAATG GCAGTGCAAT TATAGGCAAC GGTTTTCCAA GTCGAGTTGA
TAATGTTACA GGGTCTGTGA GTGTCAGTTC TAGTTCTGGG CGAGGAGAAT CTGGCCAAAG CTCAGGCAAT GGACGTGTGT
TTGAACACTT GTCCTTTCCT CCTCTTCAAG ACCAGGATAT TCCTGATGCA AGGATGGACT CTGCTCCTGA TGAAACCTCA
TTCCCTTCCC TCTCAGAGCA GCAAACCAGA TATGCTCATG CTCTTAGTCA GAGTTCCCTT GCTGCCAAGC TTGGGGATGA
GTTATTATTC CCTCCACTAC CTGGGTCAAG TAGCAACAGG GGTTCTACTT CAACTCAACA GGGGCTACAA AGTCTAGCGA
AGAACACACT TGCATCAAGG CTTCAGCAGC GTAGCAAGGG CAGTGTGAAA GTACTTCATT CTGCCCGGCC TCGCCCATCT
GAAAATCCTG AATCAGTCCC TCCTGTTTCT AGTTCCCCAC AGATGTGGCC TACACCTGAT CAGGGGCTGC TTCATTCTAG
TTCTTCCCAG CTTCGAATTG TAAGAGAAAA TGGGATTATG TCATCTGCCG ACTCGGCATG GAATCCTGGA GGTGGAGCTT
CAAACAGGAT GAAGCACTCT GTTTCTACTC CTAATCTTAT GTCTGGTGGG TCCTCTGTTC AGGCACTAAG TACATCTAAC
GGTGGCAATA AAAAACAACA GCCACCACAA AGCAGCCAAA CATTGCCTGC TGCTGATGAT GTTCGTGCTG CCAATAAGAC
CCTGGTTGAA AGAATGCGCA GTGCTTTAGG CATGGATGAA GATAGGTACT CTGCATTTAA AGAAATCGCT GGTGAATACC
GTCAAGGCAT CATTGGTACT TCAGAATATC TTTCATATGT TGAGCAATTT GGTCTGTCAC ACCTTGTGCC TGAAATGGCT
AGGCTGTTAC CTGATCCTCA GAAGCAGAAA GAACTTGCTG ATGCCTATCA CACCAATATA CGCTTCAGAA GCCTCCAAGA
GAACAGTGAT GGTTTAACCA TTACCTCAAA GGAGGGTGGC CGCAAGAAAA AGGGCAAGGG AAAATCTCAT GATGTTACAG
AAACTAGTGC TGCTCCTGCT AAGGATATGA AGGATTCACT AGCAGATAGC TTCCTGGACA CTGTAAGGAA GCTTCAGTTA
AACAAGACTC AGGAAGGAGA GGCTGAGGTG CTGTCAAGGG ATGGGTATCG ATCTTCCAAG GGAAAGGCCC AACTAATAAC
TGGAGGTTCA TCATCTAGTA CACCATGTCT AGATGGTGAT CATGGTGCCA TTTCAATGGC TTCTTGTGCC AAAGATGATG
TAGGCAAGGG AGGAGGTAGC AGCAACAGCA ACATCAACAA ACAATCAAAG AAGACATCAA AGTTTCTCAG AGCCCGATTA
GGTGATAACT CCTTAGCTAC ACTTGATTTG AGTCGTCCTA CCATGAGCCC TGAACGACCA GAAAGGGAAT CGCAAGGCCC
ACAGGTAGGG TTGCCTATGC GAGGTGTTTG GAAAAATGGA GGGGGCCAGA AGCTCTTTAC GGGCAATGGA AGGAAGTAAA
ATCATTTTGC AGATGCAGTT TGACTTTTGA AACGAGCTGG TCAATGGTAC AAGCAGATTC TGTTGCCAAG TGTGCATATT
TTGTGATCAG TTGGTTAGCT GGTCGTGGGA GAGCTTTATT GCTCCTTTGA AGATCATCGC CTTTGAATTA CACCTCACTT
TCTTGTTTTC TTTGCCAAAA CATCAACTGA GGCTGAAACT TGAAACAGTA ATGGCGTGAT ATTACGTTAC TGGCCAGTTA
GTGGAATCCA TTGGTAGATG GTATTTTACA TGAGCTCTGC CAAATATTAT AGTTACTTTA TCACTTTGTT TGTGCTGGAT
TGCAGTCAAA GACATGTATT TAGTGTGTCT GTGATCAGGC CGACCCTAAC TGAATTCGTG AAAGTTGAAA TCTCAATGTT
CTTCGTGTTA TTTAAACGGA ATTGCTAGAA AACTCTTTCG TAAGTTTTTT GCTCCCAAAA CTTTTAGATT TGTGACCATA
GGATCACCTT GAGATTTGTG CATGAAGGGG GAAAAATACT ATAAAGAAAA TTTCACAGT

Locus: Os05g0279400

Loading...

Locus: Os05g0279400

Loading...