Os05t0304800-01

Locus

Os05g0304800

Description

Histone-fold domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP5K

CGSNL Gene Name

HAP5K SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP5K, OsNF-YC11, NF-YC11, OsNF-YC12, NF-YC12, NFYC12

Oryzabase Gene Name Synonym(s)

Nuclear Factor Y subunit C11, NUCLEAR FACTOR-Y subunit C12, NUCLEAR FACTOR-Y subunit NF-YC12, NF-YC transcription factor 12, NF-YC subunit 12, NF-YC family 12

Transcript Evidence

AK242136 (DDBJ, Best hit)

Protein Evidence

NP_001055144.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Cellular Component: intracellular (GO:0005622)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J075149P12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0304800-01)

Others

Oryzabase (20926)

KEGG (Os05t0304800-01)

Transcript

1360 bp

>Os05t0304800-01 Histone-fold domain containing protein.
ATCGACCACACCATAAATTGGTCACCTGCTTCAACATCTTGATATAAGAAAGGAGTAAAG
AAATGGCGATTCCAACAAAGGAGGAGGTGGAGCAGAATGAGGAGGACAATACATTTTCAA
GGTTGCAATTGCTTGCACAACAACGGCATGCCATGGAGGAATTCTGGAGGAGGAGCCAGG
AACAAATCGAGGCATCTGCAGGCAACCATGAGCATATACTACCAATTGACTGCGTGAAGA
ATGTCATTCGACCAAAGAATGATGCTATGATGCTATCTGCTGACACACCAACTTTTGTGA
CAAAACTTTGTGAGCTCTTCGTGCAGGAGCTCACCCTCCGTGCATGGGTATGTGCCAACT
CTCACAACCGTGACATCATATTAGGCACAGACATTGCTGAGGCAATCACCACCACTGAAT
CCTATCACTTTCTTGGTAATGTACTTCGTAGCCACAAGGCACTAGGAAGTACTGCTCCTG
ACATAGATACTTCTGCTAGGAAGCATATTAAGCTAGACCAAATGACCTCACTCTACCATC
CTACCCAAGAAATGCAGGCCTCACGTTTAGCTGGGTATCCACCCCATGTTCCTATATATC
CTCCTATAGGTCAAATGGGAACTCAACACAAGCTGTCTCCATTCACTTTTATGATGCAAG
GAGAATCTCTTCTCAACATGAAAAGAGAAAAATCCCTAGTTAATGAAGTGATGGTATGCA
CCAACAAGATGAGCATAAACAACTTTGATGGAGCTACTAGTATTGGTGGTGGTAGTAGTA
GTGATGTTGCTATTGTTGTCCAGCAAGGGGAAACTACACACCCATTCTCATCCCAGAATG
CATGTCCTTCCCTAGAAGATAACTATGTTGTTCCCATGCCTACGGGACATGTTCAGAGTT
TTAGCCCTCCTACTAATATCAATGTCAAGAAGCTACATCAAGAGGAGAAAAACATCTATT
CACAAGATGTTGCTGAAGAGGACATGTCCAATGAGTCTTTGGAGGGAAGCCAGAAGGATG
AGGACCTATTTCTTCATGAGAAATAATTTCCTCCATTTATTTAGAATATGGAAGAGGAAT
ACAACAATGGCAACGATATTCATGATGGTAATTTCTCCAAATCAAGCAACAGTATCAAGA
ATTACTAAATAAACAACAAATCAAAGGAGGATGCATCTTAGCTATGTTTATCCAATGATG
TTGTATAGTTTACCTTATACTTTACTCAAGATTAATAAAAAATAATTTGTGTGTGATTCC
AGTGGTTTACCTTGTGTTTCCATCTACCTTTGTATGGACAATAATAAAAAGATTATTGTT
TGTTTGATAATTCAATAATAAAACATTCATAAGTTGTATC

CDS

984 bp

>Os05t0304800-01 Histone-fold domain containing protein.
ATGGCGATTCCAACAAAGGAGGAGGTGGAGCAGAATGAGGAGGACAATACATTTTCAAGG
TTGCAATTGCTTGCACAACAACGGCATGCCATGGAGGAATTCTGGAGGAGGAGCCAGGAA
CAAATCGAGGCATCTGCAGGCAACCATGAGCATATACTACCAATTGACTGCGTGAAGAAT
GTCATTCGACCAAAGAATGATGCTATGATGCTATCTGCTGACACACCAACTTTTGTGACA
AAACTTTGTGAGCTCTTCGTGCAGGAGCTCACCCTCCGTGCATGGGTATGTGCCAACTCT
CACAACCGTGACATCATATTAGGCACAGACATTGCTGAGGCAATCACCACCACTGAATCC
TATCACTTTCTTGGTAATGTACTTCGTAGCCACAAGGCACTAGGAAGTACTGCTCCTGAC
ATAGATACTTCTGCTAGGAAGCATATTAAGCTAGACCAAATGACCTCACTCTACCATCCT
ACCCAAGAAATGCAGGCCTCACGTTTAGCTGGGTATCCACCCCATGTTCCTATATATCCT
CCTATAGGTCAAATGGGAACTCAACACAAGCTGTCTCCATTCACTTTTATGATGCAAGGA
GAATCTCTTCTCAACATGAAAAGAGAAAAATCCCTAGTTAATGAAGTGATGGTATGCACC
AACAAGATGAGCATAAACAACTTTGATGGAGCTACTAGTATTGGTGGTGGTAGTAGTAGT
GATGTTGCTATTGTTGTCCAGCAAGGGGAAACTACACACCCATTCTCATCCCAGAATGCA
TGTCCTTCCCTAGAAGATAACTATGTTGTTCCCATGCCTACGGGACATGTTCAGAGTTTT
AGCCCTCCTACTAATATCAATGTCAAGAAGCTACATCAAGAGGAGAAAAACATCTATTCA
CAAGATGTTGCTGAAGAGGACATGTCCAATGAGTCTTTGGAGGGAAGCCAGAAGGATGAG
GACCTATTTCTTCATGAGAAATAA

Protein

328 aa

>Os05t0304800-01 Histone-fold domain containing protein.
MAIPTKEEVEQNEEDNTFSRLQLLAQQRHAMEEFWRRSQEQIEASAGNHEHILPIDCVKN
VIRPKNDAMMLSADTPTFVTKLCELFVQELTLRAWVCANSHNRDIILGTDIAEAITTTES
YHFLGNVLRSHKALGSTAPDIDTSARKHIKLDQMTSLYHPTQEMQASRLAGYPPHVPIYP
PIGQMGTQHKLSPFTFMMQGESLLNMKREKSLVNEVMVCTNKMSINNFDGATSIGGGSSS
DVAIVVQQGETTHPFSSQNACPSLEDNYVVPMPTGHVQSFSPPTNINVKKLHQEEKNIYS
QDVAEEDMSNESLEGSQKDEDLFLHEK*

5'UTR

chr05:13749904..13749955 (+ strand) : 52 bp

chr05:13750153..13750162 (+ strand) : 10 bp

CDS

chr05:13750163..13751146 (+ strand) : 984 bp

3'UTR

chr05:13751147..13751460 (+ strand) : 314 bp

FASTA

>Os05t0304800-01 class=Sequence position=chr05:13749904..13751460 (+ strand)
ATCGACCACA CCATAAATTG GTCACCTGCT TCAACATCTT GATATAAGAA AGGTTGTTTA TTATATCATT ATTATGTACT
TCTACTAATT CTTGAGTGTT AGTGTAAATT GTGTTAGTGG CTATACTTCC AACGAGAAGC AATGTAGTTT CTATTCAATT
TACATATTTT TACTGGGAAG ATGAAATAAG TTGTTGTTTC AAGCAAGTAC TTAACTGAGT TATTGTTCAT GCATTACTTA
AAAATGTAGG AGTAAAGAAA TGGCGATTCC AACAAAGGAG GAGGTGGAGC AGAATGAGGA GGACAATACA TTTTCAAGGT
TGCAATTGCT TGCACAACAA CGGCATGCCA TGGAGGAATT CTGGAGGAGG AGCCAGGAAC AAATCGAGGC ATCTGCAGGC
AACCATGAGC ATATACTACC AATTGACTGC GTGAAGAATG TCATTCGACC AAAGAATGAT GCTATGATGC TATCTGCTGA
CACACCAACT TTTGTGACAA AACTTTGTGA GCTCTTCGTG CAGGAGCTCA CCCTCCGTGC ATGGGTATGT GCCAACTCTC
ACAACCGTGA CATCATATTA GGCACAGACA TTGCTGAGGC AATCACCACC ACTGAATCCT ATCACTTTCT TGGTAATGTA
CTTCGTAGCC ACAAGGCACT AGGAAGTACT GCTCCTGACA TAGATACTTC TGCTAGGAAG CATATTAAGC TAGACCAAAT
GACCTCACTC TACCATCCTA CCCAAGAAAT GCAGGCCTCA CGTTTAGCTG GGTATCCACC CCATGTTCCT ATATATCCTC
CTATAGGTCA AATGGGAACT CAACACAAGC TGTCTCCATT CACTTTTATG ATGCAAGGAG AATCTCTTCT CAACATGAAA
AGAGAAAAAT CCCTAGTTAA TGAAGTGATG GTATGCACCA ACAAGATGAG CATAAACAAC TTTGATGGAG CTACTAGTAT
TGGTGGTGGT AGTAGTAGTG ATGTTGCTAT TGTTGTCCAG CAAGGGGAAA CTACACACCC ATTCTCATCC CAGAATGCAT
GTCCTTCCCT AGAAGATAAC TATGTTGTTC CCATGCCTAC GGGACATGTT CAGAGTTTTA GCCCTCCTAC TAATATCAAT
GTCAAGAAGC TACATCAAGA GGAGAAAAAC ATCTATTCAC AAGATGTTGC TGAAGAGGAC ATGTCCAATG AGTCTTTGGA
GGGAAGCCAG AAGGATGAGG ACCTATTTCT TCATGAGAAA TAATTTCCTC CATTTATTTA GAATATGGAA GAGGAATACA
ACAATGGCAA CGATATTCAT GATGGTAATT TCTCCAAATC AAGCAACAGT ATCAAGAATT ACTAAATAAA CAACAAATCA
AAGGAGGATG CATCTTAGCT ATGTTTATCC AATGATGTTG TATAGTTTAC CTTATACTTT ACTCAAGATT AATAAAAAAT
AATTTGTGTG TGATTCCAGT GGTTTACCTT GTGTTTCCAT CTACCTTTGT ATGGACAATA ATAAAAAGAT TATTGTTTGT
TTGATAATTC AATAATAAAA CATTCATAAG TTGTATC