Os05t0333500-01

Locus

Os05g0333500

Description

Heat shock protein DnaJ family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA7, OsDnaJ

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A7, rice DJA6 homolog

Transcript Evidence

AK243178 (DDBJ, Best hit)

Protein Evidence

Q948S9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

Heat shock protein DnaJ, N-terminal (IPR001623)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ (IPR003095)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ (IPR012724)

Heat shock protein DnaJ, conserved site (IPR018253)

Full-length cDNA

J100036P15 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0333500-01)

Others

Oryzabase (12144)

Transcript

2192 bp

>Os05t0333500-01 Heat shock protein DnaJ family protein.
gatgaactttttTGGGAGATGAGGCGCCTGTGCATATGACCCATAGGCAGGCGACAACGC
GGCAGCAGAGCGCTGCACGACCTCCGCCTCCCCAATCCGTCCCGTCTCCTCGCCCGCCGC
CCTCGACTCCCGTCTCCTCGCCTGCCGCTGGCGCCGATCTCCATCCTGCTAGCAGAGGTG
GCGCCGGCGTCCTCCTGCTCCCGCCGCATTCGCATCCTAATCCATCCCATCCGGCCTCGG
CCTCGAATTTCGTCTCCTCGCCCGCCGCTTGCGCCGATCCCCATCCTGCGAGCAGAGGTG
GCGCCCGGCGTCCTCCTTCTTCCACCGCATCGTCGCTCGCCGCTAGTATATTGAAGGTTG
AAGCTTTGTGGGTATCCAGCAAGTATTTCAATGGCGTTGCTACAGTTTGGAGGTACCTTG
GCCCCCAAACTTGGGGAAAAACCTCAGCTGTTGCCCAGGTCACCTGCACTTACAAGAGTT
ATTTATGCTGATCCAAGATTTCTGGTGTCGAAAAGTGGTAGTGGAGGCAGGCTTAAACAC
CTTGTATCACCTACTGCTAGTTTACAATCACGGACATCTTCTCGACTATTTAACCATGCA
CCATCACCGAGATTTCGCCATCGAAGGAGTTCAAGGTTCATTGTCAGAGCTGATGCTGAT
TTCTATTCCACACTTGGTGTTTCAAGAAATGCTAGTAAATCTGAAATCAAGAGTGCCTAT
AGGAAGCTTGCTAGGAGCTACCATCCTGATGTGAACAAAGATCCTGGTGCTGAACAAAAG
TTCAAGGATATTAGCAATGCTTATGAGGTTTTGTCTGATGATGAGAAGCGATCAATCTAT
GATAAATATGGAGAAGCTGGTTTGAAGGGTGCTGGAATGGGAACAGGAGATTACTCAAAC
CCATTCGATCTCTTTGAATCATTATTCGAAGGCTTTGGTGGAATGGGGGGAATGGGAGGC
CGTGCTGCTCGGAACAGACCAATGCAGGGTGATGATGAGGCCTACAATCTGGTACTCAAT
TTCAAGGAAGCGGTGTTTGGTGTAGAGAAAGAAATTGAGATCACCAGACTGGAAGGCTGT
AATACATGTGATGGAACTGGTGCCAAGCCTGGAACGAAACCAACCACATGCAAAACATGT
GGAGGACAGGGACAAGTGGTCTCCTCAACAAGAACGCCACTTGGAATATTCCAGCAGGTC
TCCACCTGCAATACTTGCGGAGGCACTGGTGAATTCTCTACCCCGTGCAACACTTGTGGG
GGTGATGGCCGAGTGCGGAAGACAAAAAGGATCAGTCTAAAGGTTCCTGCTGGTGTTGAT
TCTGGAAGCAGATTGAGGGTCCGGTCTGAGGGGAATGCTGGGCGGAGAGGAGGCCCTCCT
GGAGATCTTTATGTGTTTATTGATGTTCTCTCTGATCCTGTTCTTAAGCGAGATGGGACA
AACATTCTATACACATGCAAAGTTTCATATATTGACGCAATTCTTGGGACAACCGTCAAG
GTTCCCACTGTTGATGGGATGGTTGACCTGAAGATCCCCTCCGGTACCCAGCCAGGCACA
ACGTTAGTGATGTCCAAGAAAGGTGTCCCACTCCTCGGGAAGTCAAATGCTCGTGGAGAC
CAGCTAGTGCGTGTGCAGGTCGAGATTCCAAAGCGTCTGAGCAGCGACGAGAGGAAGCTG
ATTGAAGAACTTGCAAACCTAAACAAGGCTCAAACAGCAAACAGCAGGAGATAATTCCAT
GAGGCTTCATTGGACAAAATGCTTTGGCAATATGCAATTTTAACGCAAATTGCAGTGACT
AAGTGAGCATGAACTGGTAAATCACTTCACAAACTGTACGCTCATGCTGCGCCGTACCAT
CGGTGGGAACTGTGAATTCTCATGTCTGTAACTTCATTTTTAAGCCATAGAAATCTAGTT
CCATCCAAAACACCAAAACGGATGGTGTTTTACAGTAGCTTGTCATATGCTTTTAGGCGA
GCTTATTAGTCTATTTTTCATAATACTTTTTCACAATTTTGAAAGGCCTAGGGAGAAATA
TTTAATGGTGCAAAAGGGACGAGTTTTGAAACATTTGTTTGTCGCAGAAGCACCAGACCA
TTCTGATTGTTATTGTAAGCTGTAACATCAAAGTTTTGGCAGCAGGTTTTCATGTGCTCT
TAAGCGTTGGGGGTTTGTTCCGTTTGGTTTTC

CDS

1344 bp

>Os05t0333500-01 Heat shock protein DnaJ family protein.
ATGGCGTTGCTACAGTTTGGAGGTACCTTGGCCCCCAAACTTGGGGAAAAACCTCAGCTG
TTGCCCAGGTCACCTGCACTTACAAGAGTTATTTATGCTGATCCAAGATTTCTGGTGTCG
AAAAGTGGTAGTGGAGGCAGGCTTAAACACCTTGTATCACCTACTGCTAGTTTACAATCA
CGGACATCTTCTCGACTATTTAACCATGCACCATCACCGAGATTTCGCCATCGAAGGAGT
TCAAGGTTCATTGTCAGAGCTGATGCTGATTTCTATTCCACACTTGGTGTTTCAAGAAAT
GCTAGTAAATCTGAAATCAAGAGTGCCTATAGGAAGCTTGCTAGGAGCTACCATCCTGAT
GTGAACAAAGATCCTGGTGCTGAACAAAAGTTCAAGGATATTAGCAATGCTTATGAGGTT
TTGTCTGATGATGAGAAGCGATCAATCTATGATAAATATGGAGAAGCTGGTTTGAAGGGT
GCTGGAATGGGAACAGGAGATTACTCAAACCCATTCGATCTCTTTGAATCATTATTCGAA
GGCTTTGGTGGAATGGGGGGAATGGGAGGCCGTGCTGCTCGGAACAGACCAATGCAGGGT
GATGATGAGGCCTACAATCTGGTACTCAATTTCAAGGAAGCGGTGTTTGGTGTAGAGAAA
GAAATTGAGATCACCAGACTGGAAGGCTGTAATACATGTGATGGAACTGGTGCCAAGCCT
GGAACGAAACCAACCACATGCAAAACATGTGGAGGACAGGGACAAGTGGTCTCCTCAACA
AGAACGCCACTTGGAATATTCCAGCAGGTCTCCACCTGCAATACTTGCGGAGGCACTGGT
GAATTCTCTACCCCGTGCAACACTTGTGGGGGTGATGGCCGAGTGCGGAAGACAAAAAGG
ATCAGTCTAAAGGTTCCTGCTGGTGTTGATTCTGGAAGCAGATTGAGGGTCCGGTCTGAG
GGGAATGCTGGGCGGAGAGGAGGCCCTCCTGGAGATCTTTATGTGTTTATTGATGTTCTC
TCTGATCCTGTTCTTAAGCGAGATGGGACAAACATTCTATACACATGCAAAGTTTCATAT
ATTGACGCAATTCTTGGGACAACCGTCAAGGTTCCCACTGTTGATGGGATGGTTGACCTG
AAGATCCCCTCCGGTACCCAGCCAGGCACAACGTTAGTGATGTCCAAGAAAGGTGTCCCA
CTCCTCGGGAAGTCAAATGCTCGTGGAGACCAGCTAGTGCGTGTGCAGGTCGAGATTCCA
AAGCGTCTGAGCAGCGACGAGAGGAAGCTGATTGAAGAACTTGCAAACCTAAACAAGGCT
CAAACAGCAAACAGCAGGAGATAA

Protein

448 aa

>Os05t0333500-01 Heat shock protein DnaJ family protein.
MALLQFGGTLAPKLGEKPQLLPRSPALTRVIYADPRFLVSKSGSGGRLKHLVSPTASLQS
RTSSRLFNHAPSPRFRHRRSSRFIVRADADFYSTLGVSRNASKSEIKSAYRKLARSYHPD
VNKDPGAEQKFKDISNAYEVLSDDEKRSIYDKYGEAGLKGAGMGTGDYSNPFDLFESLFE
GFGGMGGMGGRAARNRPMQGDDEAYNLVLNFKEAVFGVEKEIEITRLEGCNTCDGTGAKP
GTKPTTCKTCGGQGQVVSSTRTPLGIFQQVSTCNTCGGTGEFSTPCNTCGGDGRVRKTKR
ISLKVPAGVDSGSRLRVRSEGNAGRRGGPPGDLYVFIDVLSDPVLKRDGTNILYTCKVSY
IDAILGTTVKVPTVDGMVDLKIPSGTQPGTTLVMSKKGVPLLGKSNARGDQLVRVQVEIP
KRLSSDERKLIEELANLNKAQTANSRR*

5'UTR

chr05:15623876..15624217 (- strand) : 342 bp

chr05:15620743..15620790 (- strand) : 48 bp

CDS

chr05:15620615..15620742 (- strand) : 128 bp

chr05:15620355..15620493 (- strand) : 139 bp

chr05:15620211..15620268 (- strand) : 58 bp

chr05:15619421..15619463 (- strand) : 43 bp

chr05:15619207..15619255 (- strand) : 49 bp

chr05:15619029..15619109 (- strand) : 81 bp

chr05:15618093..15618938 (- strand) : 846 bp

3'UTR

chr05:15617635..15618092 (- strand) : 458 bp

FASTA

>Os05t0333500-01 class=Sequence position=chr05:15617635..15624217 (- strand)
gatgaacttt ttTGGGAGAT GAGGCGCCTG TGCATATGAC CCATAGGCAG GCGACAACGC GGCAGCAGAG CGCTGCACGA
CCTCCGCCTC CCCAATCCGT CCCGTCTCCT CGCCCGCCGC CCTCGACTCC CGTCTCCTCG CCTGCCGCTG GCGCCGATCT
CCATCCTGCT AGCAGAGGTG GCGCCGGCGT CCTCCTGCTC CCGCCGCATT CGCATCCTAA TCCATCCCAT CCGGCCTCGG
CCTCGAATTT CGTCTCCTCG CCCGCCGCTT GCGCCGATCC CCATCCTGCG AGCAGAGGTG GCGCCCGGCG TCCTCCTTCT
TCCACCGCAT CGTCGCTCGC CGGTGAGCAT CCCTCCCTAC CCACACCTCA TCAGGTATTC TGCGTTATCC CTCAAAAAGT
TTGGGGGTTC AACCGAAACA GGGTTAGATC TGCCTCTGCC CAGCTCCACC TACTTTCAAG TTGTTAATTT TGATTTCCGT
TTTTAGCAGA TGTAATTTGG TTATTGAATC TCATCCAAAC ACCCTTAGAA CGAAAAATGT AAGCTCACAT AATTTGTACT
CATCCAAACT CACATAAATT TCTTAAGAAG AATCTAGACC ACAAACTACC CATAGTCACA CAAAATATCT TTTTATCAAG
GTATATTCTT ATAAGTAATT TTTATTCCAC AAAATTTTCT AAAGGACATA CTGTGACACT TGGCATGAAT CTAATTTAAC
ATTCTTTCTT TATCAGGTTA TAAATTGAAA CCATTGAACG TACTTTGTCT TCCCGTCCCT AAAACATTGT GATATATCTG
TAATATTTTA ATATTTTTAA TTTTAAAAAT AATTTAGACT AATAATATAG ATATTTAAAT TAGGTAATTA GTAAATTCAA
ATCAACTATA GTTTGGAATA AAAAAACAAA ATGATATATG CCAAGTACAA TCTAATAACA ATAGAATGCA CTTTTGGTTA
ATGTTTACTC CTAATTTCTT AATTTCTAGT TTGGCTCCCT CCACCGTTAT GGTAAAAAAT CGTTATGTTT TAACTATTTA
TCTGCTAGAG CATATGTAAT ATTTATGTAA ACTATGTTCT TTATTACCAA TCAAAATAGA CACCTTACCT ACTTTCATCA
AAAGAAATAA AAAACAACAC TAATAAATAA TGAACATGAT TTTAGATGTA GTAGGTATTA TTCTGGAATA CTCCTCGTCG
GAAACATATG GAACGCATTT CCCTCAAAAC GCAAAAACCG GGGCCCCGAG CCCTCGACAC CAACCCCGTC GGATGTGAAG
CCGACGGCCC AGATGGAGGC CAGCGGTGCC AATGCGTAGG CCACGCGTGC CTCTGCGCAA ATCTTATCTC CCGGGAGGCT
CCGCTCCACT TCCCTTCCCG AGTCACTCAA ACCATCCAAT CCCTCCACCT TCCCTTCCCT TGCCCCCATT TCCCACCGCT
GCCGCGCCTT GCCCCCATTC CCCACCGCCG CGGTGCGGCC GCCGACGACC TCCACACCTC GAGCACGCGT GCCGCCGACG
AGGTGCCCTT CTCTCTCTCA CTCTCGTCTC CCCCATTCCT CCCCTCTTCC CGTGTCCCGT CGTCCACAGC TCCCCGACCA
AATCCCTAGC CCTACTATTC CCCACCCACC AGGCCTCCCT CGCGCGGTCA CGCCGCACGA TCGGGCCCGA CAGTGCCGCC
GCTTCTTGCC CTACTGCCGC GGTTCTTTAA GAGGTTGTCC TGATTTGCTG CAGCCCAGTA GGTATTGTAT ATTTTTCTCG
TTGGTAAATT TGGCAGCAAA AAAAAAAGTG TTTAATACCG AATGTTATAA ACCCGAGCAT CTCATGGTGT CTATATATCA
GCATATATGA TATGTTAGGA TTGGTAAGGA TGCATATCAC ACGATTACAA TTACCAACTC CACCTCGAAG ATAATAAGCC
CAATAGTCTA ACCCTAAAAT CCCTCCCTAC CTGTCCGTTC CTTTTCTCAA CGATTCCCAG AAGCGCCGCT TATCCTCGAG
CCGAGTGGCC GACAGCGCCG CCCAGGAGTC GAGGAGTCGT AGCTCGTAGC GCCACCCTTC CTTGTGCGCG CGGTTGTGCC
CTTTCTCGCC GCCGGTCTCC CCGCTTCACC TCGCATCCTC AACGTCAACA GCTGCCATCC GCTCCTCACG CTGGCTATCG
GGAAGGTCAG TAGGTCACGC CGTCTCCTTC CCTACTTGCC TCCGGCCACC CTAAGACCCC AACTCGCCTC TTCCTCGCGC
GAATCGCCTA GTTACCCGGC GGGCGACACC CCTACTCCCG TGTGGCCGCG CGTCCTCGTC GTCTTGCTTG CCCTGCTTTC
tttggctcac gagccaaacg agcccgctcg agctagacaa ctagccgagc ctagcttggt tttctagctc gttaggataa
taagccgagc ctagctagac cgagccgagc tggctcgaca tccaccccCT ACACGCGTGC CTTTGCCCAA ATCTTATCTC
CCGGGAGGCT CACTTCCCTC CCCGAGTGGC TGCGACGACC TCCGCAGCTC GAGACGAGGT GCCACTTCTT CTTCTCTCTC
TCCATCCCCC ATTCCTCCCC TCTCTTCCCG TGTCCCGTCG TCCACAGCTC CCCGACCAAA TCCCTAGCCC TACTATTCCC
GCGCCCGCCC CTCCCTCGCG TGGTCACGCC CGACAGCGCC GTGCCGCCAC CGCTTCTTGC CCTATTGCCG CAGTTCTTCA
AGAGGCTTTT GTCCTGATTT GCTGCAGCCC GGTAGGTATT ATATATTTTT GTGGTTGGTA AATTCGGCAG CAAAAAAGAA
AAAAAAATAA TACCGAATGT TATAAACCCG AGCATCTCAT GGTGTCCATG TATCTGCATA TATGATATGT TAGGATCGGT
AAGGATGCAT AGCACACGAT TACAACCACC AACTCCACCT CGAAGATAAT ATAGCGTAGT GTTTGCCAGC TTCGCACGTT
ATGGCCGAAT TCTTATGTAT AACAAATTTA CCATGGTATG TAAGCTCAAA AATGCAAAAC TAATTATCCT CGAACCTAAA
AAAGTGTATA CATGCAAGAG ATGATCAATC CCACATATAA ATACATGCAA ATAATACACG CCCTGCTCGA CAGCCACTGC
TGCAGCTGTA CCTAAGCTAC TAGCTGTGGC CGCGGTGTGC ATCCACAACC GTAGCAATGG CTGCTCAGCA GGCCCATGAT
CTCTGAAAAA GTTCCTGCAA GCAGTACATA TGTATGTACA GTTGTACACA CCCTCGCCCC TATTCATCCT CTTAAAGGAG
TAAGGAGTAA TGACAGTCGA TATGTGTTGG TTGATTAAAA TTTAGAAGAG AACGTTTTTG AATAGAATTG TGAACTTACT
CGAATATCGT TCTTTTGTGT ATTGCTTTTG TTATGCTTCA CCTGACTCTA TCTCTGTGAA ATGGCAGCTA GTATATTGAA
GGTTGAAGCT TTGTGGGTAT CCAGCAAGTA TTTCAATGGC GTTGCTACAG TTTGGAGGTA CCTTGGCCCC CAAACTTGGG
GAAAAACCTC AGCTGTTGCC CAGGTCACCT GCACTTACAA GAGTTATTTA TGCTGATCCA AGATTTCTGG TGTCGAAAAG
TGGGTATGTG AATGTGTTCT GATCAGTGAG ATGTACTAGG AATACTAAAA TAAAGGACAC ATTGATATTA TAAAAAGGCA
AGATTTCTGA GTAAACTGAA GATGATATAT CTCTTTTTGT GCAGTAGTGG AGGCAGGCTT AAACACCTTG TATCACCTAC
TGCTAGTTTA CAATCACGGA CATCTTCTCG ACTATTTAAC CATGCACCAT CACCGAGATT TCGCCATCGA AGGAGTTCAA
GGTTCATTGT CAGAGCTGAT GCTGTGAGTT ACTTCATTTG CTTTTCTTCT TTGCTGGTAT TATTAGAAAA TCCAGTTTCC
TGACATGGAT TTGATATTTT AATTTACAGG ATTTCTATTC CACACTTGGT GTTTCAAGAA ATGCTAGTAA ATCTGAAATC
AAGAGTGGTA GGTGTGGTTT TATTTGTCAG TTTAGGGCAT GCAGTGATTG GTGCTCCGTA CAATCGTAGG AGTATTACCC
AGCTTTGCTT CTTCTCTAGT TTGAGCCTGG TTGTAGGTTT GTAGGTACCC TATAATTTAC CAAACAAACC AGACTGCTTT
CATGTGGCTA TTAGTCGTAG ATTACTAGTT TTAAATCATA CTGTTCACGT GTGAAACAAA ATATATGTAC AACAGAAACT
GTTAAGCTTC CCAGGGAAGA TATGAAATAT ATAACTAGTC TTTTTCAAAC TTGGCCATAG TGAGCTTTAT GGCCCACTTG
TTTGTTCTCG AAAGCTTTAC TATTCCTACT AGTAACTCAA ATATTTGCTA TTTCATCTAA TTTGAAGGCT ATCTCAGCAA
AACCCCTTGA ACTATTCTAA GACAAGCCTA TGCTGTCTTC AGTATCATTT TCTGCAACTG ATCATCTTGC GTTCTAGACT
CGATACTGTT TATATTTCTG AAAATCTATT GTTGGCAACT TCTCATTGAT GCATTGTTTG TATGGCCCTC AATCCCTGCC
CTCCACGTGT GTGGGCAGAA ATTTTGAACA AAAATCCCAA CCCACACCCG TAGATAATCT AGGATTTGTC CTATCCAAAT
AATGCCTAAG GGGATATTAT GTTAGAAATC CTTCAGAGTC AATTTTGATC AAAATATGTG TAGTAGTTTA ATGTTGCTTT
CTATTGTAGT TCTAAAATGG TCCTTCTTTT CCAGCCTATA GGAAGCTTGC TAGGAGCTAC CATCCTGATG TGAACAAGTA
AGTACTAACC ATTATATGGG AATTGTGTTT CAGCTACACT CGATATATTG CTTCTTTTTC TCCTTTCGAT CCATTATAAA
CCTGAGTACT AGTTGTTGCA TTACCTTTTT CATAACTACA TAATCAAATA AGCAATTGTT ATGCTTGTGT ATTTTTCTTT
AGAGATCCTG GTGCTGAACA AAAGTTCAAG GATATTAGCA ATGCTTATGA GGTTAGTCCA GCTAACCATA ACCAAATCCC
ATTGTTTCTT ATGACTATGT TGTTGTAGGG TTACAGGTGC TTGCCAGCTA ACATAAATAG GATTGCAGGT TTTGTCTGAT
GATGAGAAGC GATCAATCTA TGATAAATAT GGAGAAGCTG GTTTGAAGGG TGCTGGAATG GGAACAGGAG TGAGTGTTCC
TAGAATGTTG TCCAATTCTG AAGTATGATC AGCATGACCT TTATATGATA TTGATTGTAT GAAATTTGTG AATCTGCAGG
ATTACTCAAA CCCATTCGAT CTCTTTGAAT CATTATTCGA AGGCTTTGGT GGAATGGGGG GAATGGGAGG CCGTGCTGCT
CGGAACAGAC CAATGCAGGG TGATGATGAG GCCTACAATC TGGTACTCAA TTTCAAGGAA GCGGTGTTTG GTGTAGAGAA
AGAAATTGAG ATCACCAGAC TGGAAGGCTG TAATACATGT GATGGAACTG GTGCCAAGCC TGGAACGAAA CCAACCACAT
GCAAAACATG TGGAGGACAG GGACAAGTGG TCTCCTCAAC AAGAACGCCA CTTGGAATAT TCCAGCAGGT CTCCACCTGC
AATACTTGCG GAGGCACTGG TGAATTCTCT ACCCCGTGCA ACACTTGTGG GGGTGATGGC CGAGTGCGGA AGACAAAAAG
GATCAGTCTA AAGGTTCCTG CTGGTGTTGA TTCTGGAAGC AGATTGAGGG TCCGGTCTGA GGGGAATGCT GGGCGGAGAG
GAGGCCCTCC TGGAGATCTT TATGTGTTTA TTGATGTTCT CTCTGATCCT GTTCTTAAGC GAGATGGGAC AAACATTCTA
TACACATGCA AAGTTTCATA TATTGACGCA ATTCTTGGGA CAACCGTCAA GGTTCCCACT GTTGATGGGA TGGTTGACCT
GAAGATCCCC TCCGGTACCC AGCCAGGCAC AACGTTAGTG ATGTCCAAGA AAGGTGTCCC ACTCCTCGGG AAGTCAAATG
CTCGTGGAGA CCAGCTAGTG CGTGTGCAGG TCGAGATTCC AAAGCGTCTG AGCAGCGACG AGAGGAAGCT GATTGAAGAA
CTTGCAAACC TAAACAAGGC TCAAACAGCA AACAGCAGGA GATAATTCCA TGAGGCTTCA TTGGACAAAA TGCTTTGGCA
ATATGCAATT TTAACGCAAA TTGCAGTGAC TAAGTGAGCA TGAACTGGTA AATCACTTCA CAAACTGTAC GCTCATGCTG
CGCCGTACCA TCGGTGGGAA CTGTGAATTC TCATGTCTGT AACTTCATTT TTAAGCCATA GAAATCTAGT TCCATCCAAA
ACACCAAAAC GGATGGTGTT TTACAGTAGC TTGTCATATG CTTTTAGGCG AGCTTATTAG TCTATTTTTC ATAATACTTT
TTCACAATTT TGAAAGGCCT AGGGAGAAAT ATTTAATGGT GCAAAAGGGA CGAGTTTTGA AACATTTGTT TGTCGCAGAA
GCACCAGACC ATTCTGATTG TTATTGTAAG CTGTAACATC AAAGTTTTGG CAGCAGGTTT TCATGTGCTC TTAAGCGTTG
GGGGTTTGTT CCGTTTGGTT TTC