Os05t0333500-02

Locus

Os05g0333500

Description

Heat shock protein DnaJ family protein, Chloroplast development and differentiation

RAP-DB Gene Symbol Synonym(s)

OsDjA7, OsDnaJ, OsDjA7/8

RAP-DB Gene Name Synonym(s)

DnaJ domain protein A7, rice DJA6 homolog

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDjA7, OsDnaJ

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A7, rice DJA6 homolog

Transcript Evidence

NM_001061762.1

AK101370

Protein Evidence

Q5W730

Literature

PMID: 26210810

PMID: 23160806

Note

Manual Curation

August 20, 2015

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Chaperone DnaJ (IPR012724)

DnaJ domain (IPR001623)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

DnaJ domain, conserved site (IPR018253)

Full-length cDNA

J033035M17 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0333500-02)

Others

Oryzabase (12144)

Transcript

2121 bp

>Os05t0333500-02 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
GCGCTGCACGACCTCCGCCTCCCCAATCCGTCCCGTCTCCTCGCCCGCCGCCCTCGACTC
CCGTCTCCTCGCCTGCCGCTGGCGCCGATCTCCATCCTGCTAGCAGAGGTGGCGCCGGCG
TCCTCCTGCTCCCGCCGCATTCGCATCCTAATCCATCCCATCCGGCCTCGGCCTCGAATT
TCGTCTCCTCGCCCGCCGCTTGCGCCGATCCCCATCCTGCGAGCAGAGGTGGCGCCCGGC
GTCCTCCTTCTTCCACCGCATCGTCGCTCGCCGCTAGTATATTGAAGGTTGAAGCTTTGT
GGGTATCCAGCAAGTATTTCAATGGCGTTGCTACAGTTTGGAGGTACCTTGGCCCCCAAA
CTTGGGGAAAAACCTCAGCTGTTGCCCAGGTCACCTGCACTTACAAGAGTTATTTATGCT
GATCCAAGATTTCTGGTGTCGAAAAGTGGTAGTGGAGGCAGGCTTAAACACCTTGTATCA
CCTACTGCTAGTTTACAATCACGGACATCTTCTCGACTATTTAACCATGCACCATCACCG
AGATTTCGCCATCGAAGGAGTTCAAGGTTCATTGTCAGAGCTGATGCTGATTTCTATTCC
ACACTTGGTGTTTCAAGAAATGCTAGTAAATCTGAAATCAAGAGTGCCTATAGGAAGCTT
GCTAGGAGCTACCATCCTGATGTGAACAAAGATCCTGGTGCTGAACAAAAGTTCAAGGAT
ATTAGCAATGCTTATGAGGTTTTGTCTGATGATGAGAAGCGATCAATCTATGATAAATAT
GGAGAAGCTGGTTTGAAGGGTGCTGGAATGGGAACAGGAGATTACTCAAACCCATTCGAT
CTCTTTGAATCATTATTCGAAGGCTTTGGTGGAATGGGGGGAATGGGAGGCCGTGCTGCT
CGGAACAGACCAATGCAGGGTGATGATGAGGCCTACAATCTGGTACTCAATTTCAAGGAA
GCGGTGTTTGGTGTAGAGAAAGAAATTGAGATCACCAGACTGGAAGGCTGTAATACATGT
GATGGAACTGGTGCCAAGCCTGGAACGAAACCAACCACATGCAAAACATGTGGAGGACAG
GGACAAGTGGTCTCCTCAACAAGAACGCCACTTGGAATATTCCAGCAGGTCTCCACCTGC
AATACTTGCGGAGGCACTGGTGAATTCTCTACCCCGTGCAACACTTGTGGGGGTGATGGC
CGAGTGCGGAAGACAAAAAGGATCAGTCTAAAGGTTCCTGCTGGTGTTGATTCTGGAAGC
AGATTGAGGGTCCGGTCTGAGGGGAATGCTGGGCGGAGAGGAGGCCCTCCTGGAGATCTT
TATGTGTTTATTGATGTTCTCTCTGATCCTGTTCTTAAGCGAGATGGGACAAACATTCTA
TACACATGCAAAGTTTCATATATTGACGCAATTCTTGGGACAACCGTCAAGGTTCCCACT
GTTGATGGGATGGTTGACCTGAAGATCCCCTCCGGTACCCAGCCAGGCACAACGTTAGTG
ATGTCCAAGAAAGGTGTCCCACTCCTCGGGAAGTCAAATGCTCGTGGAGACCAGCTAGTG
CGTGTGCAGGTCGAGATTCCAAAGCGTCTGAGCAGCGACGAGAGGAAGCTGATTGAAGAA
CTTGCAAACCTAAACAAGGCTCAAACAGCAAACAGCAGGAGATAATTCCATGAGGCTTCA
TTGGACAAAATGCTTTGGCAATATGCAATTTTAACGCAAATTGCAGTGACTAAGTGAGCA
TGAACTGGTAAATCACTTCACAAACTGTACGCTCATGCTGCGCCGTACCATCGGTGGGAA
CTGTGAATTCTCATGTCTGTAACTTCATTTTTAAGCCATAGAAATCTAGTTCCATCCAAA
ACACCAAAACGGATGGTGTTTTACAGTAGCTTGTCATATGCTTTTAGGCGAGCTTATTAG
TCTATTTTTCATAATACTTTTTCACAATTTTGAAAGGCCTAGGGAGAAATATTTAATGGT
GCAAAAGGGACGAGTTTTGAAACATTTGTTTGTCGCAGAAGCACCAGACCATTCTGATTG
TTATTGTAAGCTGTAACATCAAAGTTTTGGCAGCAGGTTTTCATGTGCTCTTAAGCGTTG
GGGGTTTGTTCCGTTTGGTTT

CDS

1344 bp

>Os05t0333500-02 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
ATGGCGTTGCTACAGTTTGGAGGTACCTTGGCCCCCAAACTTGGGGAAAAACCTCAGCTG
TTGCCCAGGTCACCTGCACTTACAAGAGTTATTTATGCTGATCCAAGATTTCTGGTGTCG
AAAAGTGGTAGTGGAGGCAGGCTTAAACACCTTGTATCACCTACTGCTAGTTTACAATCA
CGGACATCTTCTCGACTATTTAACCATGCACCATCACCGAGATTTCGCCATCGAAGGAGT
TCAAGGTTCATTGTCAGAGCTGATGCTGATTTCTATTCCACACTTGGTGTTTCAAGAAAT
GCTAGTAAATCTGAAATCAAGAGTGCCTATAGGAAGCTTGCTAGGAGCTACCATCCTGAT
GTGAACAAAGATCCTGGTGCTGAACAAAAGTTCAAGGATATTAGCAATGCTTATGAGGTT
TTGTCTGATGATGAGAAGCGATCAATCTATGATAAATATGGAGAAGCTGGTTTGAAGGGT
GCTGGAATGGGAACAGGAGATTACTCAAACCCATTCGATCTCTTTGAATCATTATTCGAA
GGCTTTGGTGGAATGGGGGGAATGGGAGGCCGTGCTGCTCGGAACAGACCAATGCAGGGT
GATGATGAGGCCTACAATCTGGTACTCAATTTCAAGGAAGCGGTGTTTGGTGTAGAGAAA
GAAATTGAGATCACCAGACTGGAAGGCTGTAATACATGTGATGGAACTGGTGCCAAGCCT
GGAACGAAACCAACCACATGCAAAACATGTGGAGGACAGGGACAAGTGGTCTCCTCAACA
AGAACGCCACTTGGAATATTCCAGCAGGTCTCCACCTGCAATACTTGCGGAGGCACTGGT
GAATTCTCTACCCCGTGCAACACTTGTGGGGGTGATGGCCGAGTGCGGAAGACAAAAAGG
ATCAGTCTAAAGGTTCCTGCTGGTGTTGATTCTGGAAGCAGATTGAGGGTCCGGTCTGAG
GGGAATGCTGGGCGGAGAGGAGGCCCTCCTGGAGATCTTTATGTGTTTATTGATGTTCTC
TCTGATCCTGTTCTTAAGCGAGATGGGACAAACATTCTATACACATGCAAAGTTTCATAT
ATTGACGCAATTCTTGGGACAACCGTCAAGGTTCCCACTGTTGATGGGATGGTTGACCTG
AAGATCCCCTCCGGTACCCAGCCAGGCACAACGTTAGTGATGTCCAAGAAAGGTGTCCCA
CTCCTCGGGAAGTCAAATGCTCGTGGAGACCAGCTAGTGCGTGTGCAGGTCGAGATTCCA
AAGCGTCTGAGCAGCGACGAGAGGAAGCTGATTGAAGAACTTGCAAACCTAAACAAGGCT
CAAACAGCAAACAGCAGGAGATAA

Protein

448 aa

>Os05t0333500-02 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
MALLQFGGTLAPKLGEKPQLLPRSPALTRVIYADPRFLVSKSGSGGRLKHLVSPTASLQS
RTSSRLFNHAPSPRFRHRRSSRFIVRADADFYSTLGVSRNASKSEIKSAYRKLARSYHPD
VNKDPGAEQKFKDISNAYEVLSDDEKRSIYDKYGEAGLKGAGMGTGDYSNPFDLFESLFE
GFGGMGGMGGRAARNRPMQGDDEAYNLVLNFKEAVFGVEKEIEITRLEGCNTCDGTGAKP
GTKPTTCKTCGGQGQVVSSTRTPLGIFQQVSTCNTCGGTGEFSTPCNTCGGDGRVRKTKR
ISLKVPAGVDSGSRLRVRSEGNAGRRGGPPGDLYVFIDVLSDPVLKRDGTNILYTCKVSY
IDAILGTTVKVPTVDGMVDLKIPSGTQPGTTLVMSKKGVPLLGKSNARGDQLVRVQVEIP
KRLSSDERKLIEELANLNKAQTANSRR*

5'UTR

chr05:15623876..15624148 (- strand) : 273 bp

chr05:15620743..15620790 (- strand) : 48 bp

CDS

chr05:15620615..15620742 (- strand) : 128 bp

chr05:15620355..15620493 (- strand) : 139 bp

chr05:15620211..15620268 (- strand) : 58 bp

chr05:15619421..15619463 (- strand) : 43 bp

chr05:15619207..15619255 (- strand) : 49 bp

chr05:15619029..15619109 (- strand) : 81 bp

chr05:15618093..15618938 (- strand) : 846 bp

3'UTR

chr05:15617637..15618092 (- strand) : 456 bp

FASTA

>Os05t0333500-02 class=Sequence position=chr05:15617637..15624148 (- strand)
GCGCTGCACG ACCTCCGCCT CCCCAATCCG TCCCGTCTCC TCGCCCGCCG CCCTCGACTC CCGTCTCCTC GCCTGCCGCT
GGCGCCGATC TCCATCCTGC TAGCAGAGGT GGCGCCGGCG TCCTCCTGCT CCCGCCGCAT TCGCATCCTA ATCCATCCCA
TCCGGCCTCG GCCTCGAATT TCGTCTCCTC GCCCGCCGCT TGCGCCGATC CCCATCCTGC GAGCAGAGGT GGCGCCCGGC
GTCCTCCTTC TTCCACCGCA TCGTCGCTCG CCGGTGAGCA TCCCTCCCTA CCCACACCTC ATCAGGTATT CTGCGTTATC
CCTCAAAAAG TTTGGGGGTT CAACCGAAAC AGGGTTAGAT CTGCCTCTGC CCAGCTCCAC CTACTTTCAA GTTGTTAATT
TTGATTTCCG TTTTTAGCAG ATGTAATTTG GTTATTGAAT CTCATCCAAA CACCCTTAGA ACGAAAAATG TAAGCTCACA
TAATTTGTAC TCATCCAAAC TCACATAAAT TTCTTAAGAA GAATCTAGAC CACAAACTAC CCATAGTCAC ACAAAATATC
TTTTTATCAA GGTATATTCT TATAAGTAAT TTTTATTCCA CAAAATTTTC TAAAGGACAT ACTGTGACAC TTGGCATGAA
TCTAATTTAA CATTCTTTCT TTATCAGGTT ATAAATTGAA ACCATTGAAC GTACTTTGTC TTCCCGTCCC TAAAACATTG
TGATATATCT GTAATATTTT AATATTTTTA ATTTTAAAAA TAATTTAGAC TAATAATATA GATATTTAAA TTAGGTAATT
AGTAAATTCA AATCAACTAT AGTTTGGAAT AAAAAAACAA AATGATATAT GCCAAGTACA ATCTAATAAC AATAGAATGC
ACTTTTGGTT AATGTTTACT CCTAATTTCT TAATTTCTAG TTTGGCTCCC TCCACCGTTA TGGTAAAAAA TCGTTATGTT
TTAACTATTT ATCTGCTAGA GCATATGTAA TATTTATGTA AACTATGTTC TTTATTACCA ATCAAAATAG ACACCTTACC
TACTTTCATC AAAAGAAATA AAAAACAACA CTAATAAATA ATGAACATGA TTTTAGATGT AGTAGGTATT ATTCTGGAAT
ACTCCTCGTC GGAAACATAT GGAACGCATT TCCCTCAAAA CGCAAAAACC GGGGCCCCGA GCCCTCGACA CCAACCCCGT
CGGATGTGAA GCCGACGGCC CAGATGGAGG CCAGCGGTGC CAATGCGTAG GCCACGCGTG CCTCTGCGCA AATCTTATCT
CCCGGGAGGC TCCGCTCCAC TTCCCTTCCC GAGTCACTCA AACCATCCAA TCCCTCCACC TTCCCTTCCC TTGCCCCCAT
TTCCCACCGC TGCCGCGCCT TGCCCCCATT CCCCACCGCC GCGGTGCGGC CGCCGACGAC CTCCACACCT CGAGCACGCG
TGCCGCCGAC GAGGTGCCCT TCTCTCTCTC ACTCTCGTCT CCCCCATTCC TCCCCTCTTC CCGTGTCCCG TCGTCCACAG
CTCCCCGACC AAATCCCTAG CCCTACTATT CCCCACCCAC CAGGCCTCCC TCGCGCGGTC ACGCCGCACG ATCGGGCCCG
ACAGTGCCGC CGCTTCTTGC CCTACTGCCG CGGTTCTTTA AGAGGTTGTC CTGATTTGCT GCAGCCCAGT AGGTATTGTA
TATTTTTCTC GTTGGTAAAT TTGGCAGCAA AAAAAAAAGT GTTTAATACC GAATGTTATA AACCCGAGCA TCTCATGGTG
TCTATATATC AGCATATATG ATATGTTAGG ATTGGTAAGG ATGCATATCA CACGATTACA ATTACCAACT CCACCTCGAA
GATAATAAGC CCAATAGTCT AACCCTAAAA TCCCTCCCTA CCTGTCCGTT CCTTTTCTCA ACGATTCCCA GAAGCGCCGC
TTATCCTCGA GCCGAGTGGC CGACAGCGCC GCCCAGGAGT CGAGGAGTCG TAGCTCGTAG CGCCACCCTT CCTTGTGCGC
GCGGTTGTGC CCTTTCTCGC CGCCGGTCTC CCCGCTTCAC CTCGCATCCT CAACGTCAAC AGCTGCCATC CGCTCCTCAC
GCTGGCTATC GGGAAGGTCA GTAGGTCACG CCGTCTCCTT CCCTACTTGC CTCCGGCCAC CCTAAGACCC CAACTCGCCT
CTTCCTCGCG CGAATCGCCT AGTTACCCGG CGGGCGACAC CCCTACTCCC GTGTGGCCGC GCGTCCTCGT CGTCTTGCTT
GCCCTGCTTT Ctttggctca cgagccaaac gagcccgctc gagctagaca actagccgag cctagcttgg ttttctagct
cgttaggata ataagccgag cctagctaga ccgagccgag ctggctcgac atccaccccC TACACGCGTG CCTTTGCCCA
AATCTTATCT CCCGGGAGGC TCACTTCCCT CCCCGAGTGG CTGCGACGAC CTCCGCAGCT CGAGACGAGG TGCCACTTCT
TCTTCTCTCT CTCCATCCCC CATTCCTCCC CTCTCTTCCC GTGTCCCGTC GTCCACAGCT CCCCGACCAA ATCCCTAGCC
CTACTATTCC CGCGCCCGCC CCTCCCTCGC GTGGTCACGC CCGACAGCGC CGTGCCGCCA CCGCTTCTTG CCCTATTGCC
GCAGTTCTTC AAGAGGCTTT TGTCCTGATT TGCTGCAGCC CGGTAGGTAT TATATATTTT TGTGGTTGGT AAATTCGGCA
GCAAAAAAGA AAAAAAAATA ATACCGAATG TTATAAACCC GAGCATCTCA TGGTGTCCAT GTATCTGCAT ATATGATATG
TTAGGATCGG TAAGGATGCA TAGCACACGA TTACAACCAC CAACTCCACC TCGAAGATAA TATAGCGTAG TGTTTGCCAG
CTTCGCACGT TATGGCCGAA TTCTTATGTA TAACAAATTT ACCATGGTAT GTAAGCTCAA AAATGCAAAA CTAATTATCC
TCGAACCTAA AAAAGTGTAT ACATGCAAGA GATGATCAAT CCCACATATA AATACATGCA AATAATACAC GCCCTGCTCG
ACAGCCACTG CTGCAGCTGT ACCTAAGCTA CTAGCTGTGG CCGCGGTGTG CATCCACAAC CGTAGCAATG GCTGCTCAGC
AGGCCCATGA TCTCTGAAAA AGTTCCTGCA AGCAGTACAT ATGTATGTAC AGTTGTACAC ACCCTCGCCC CTATTCATCC
TCTTAAAGGA GTAAGGAGTA ATGACAGTCG ATATGTGTTG GTTGATTAAA ATTTAGAAGA GAACGTTTTT GAATAGAATT
GTGAACTTAC TCGAATATCG TTCTTTTGTG TATTGCTTTT GTTATGCTTC ACCTGACTCT ATCTCTGTGA AATGGCAGCT
AGTATATTGA AGGTTGAAGC TTTGTGGGTA TCCAGCAAGT ATTTCAATGG CGTTGCTACA GTTTGGAGGT ACCTTGGCCC
CCAAACTTGG GGAAAAACCT CAGCTGTTGC CCAGGTCACC TGCACTTACA AGAGTTATTT ATGCTGATCC AAGATTTCTG
GTGTCGAAAA GTGGGTATGT GAATGTGTTC TGATCAGTGA GATGTACTAG GAATACTAAA ATAAAGGACA CATTGATATT
ATAAAAAGGC AAGATTTCTG AGTAAACTGA AGATGATATA TCTCTTTTTG TGCAGTAGTG GAGGCAGGCT TAAACACCTT
GTATCACCTA CTGCTAGTTT ACAATCACGG ACATCTTCTC GACTATTTAA CCATGCACCA TCACCGAGAT TTCGCCATCG
AAGGAGTTCA AGGTTCATTG TCAGAGCTGA TGCTGTGAGT TACTTCATTT GCTTTTCTTC TTTGCTGGTA TTATTAGAAA
ATCCAGTTTC CTGACATGGA TTTGATATTT TAATTTACAG GATTTCTATT CCACACTTGG TGTTTCAAGA AATGCTAGTA
AATCTGAAAT CAAGAGTGGT AGGTGTGGTT TTATTTGTCA GTTTAGGGCA TGCAGTGATT GGTGCTCCGT ACAATCGTAG
GAGTATTACC CAGCTTTGCT TCTTCTCTAG TTTGAGCCTG GTTGTAGGTT TGTAGGTACC CTATAATTTA CCAAACAAAC
CAGACTGCTT TCATGTGGCT ATTAGTCGTA GATTACTAGT TTTAAATCAT ACTGTTCACG TGTGAAACAA AATATATGTA
CAACAGAAAC TGTTAAGCTT CCCAGGGAAG ATATGAAATA TATAACTAGT CTTTTTCAAA CTTGGCCATA GTGAGCTTTA
TGGCCCACTT GTTTGTTCTC GAAAGCTTTA CTATTCCTAC TAGTAACTCA AATATTTGCT ATTTCATCTA ATTTGAAGGC
TATCTCAGCA AAACCCCTTG AACTATTCTA AGACAAGCCT ATGCTGTCTT CAGTATCATT TTCTGCAACT GATCATCTTG
CGTTCTAGAC TCGATACTGT TTATATTTCT GAAAATCTAT TGTTGGCAAC TTCTCATTGA TGCATTGTTT GTATGGCCCT
CAATCCCTGC CCTCCACGTG TGTGGGCAGA AATTTTGAAC AAAAATCCCA ACCCACACCC GTAGATAATC TAGGATTTGT
CCTATCCAAA TAATGCCTAA GGGGATATTA TGTTAGAAAT CCTTCAGAGT CAATTTTGAT CAAAATATGT GTAGTAGTTT
AATGTTGCTT TCTATTGTAG TTCTAAAATG GTCCTTCTTT TCCAGCCTAT AGGAAGCTTG CTAGGAGCTA CCATCCTGAT
GTGAACAAGT AAGTACTAAC CATTATATGG GAATTGTGTT TCAGCTACAC TCGATATATT GCTTCTTTTT CTCCTTTCGA
TCCATTATAA ACCTGAGTAC TAGTTGTTGC ATTACCTTTT TCATAACTAC ATAATCAAAT AAGCAATTGT TATGCTTGTG
TATTTTTCTT TAGAGATCCT GGTGCTGAAC AAAAGTTCAA GGATATTAGC AATGCTTATG AGGTTAGTCC AGCTAACCAT
AACCAAATCC CATTGTTTCT TATGACTATG TTGTTGTAGG GTTACAGGTG CTTGCCAGCT AACATAAATA GGATTGCAGG
TTTTGTCTGA TGATGAGAAG CGATCAATCT ATGATAAATA TGGAGAAGCT GGTTTGAAGG GTGCTGGAAT GGGAACAGGA
GTGAGTGTTC CTAGAATGTT GTCCAATTCT GAAGTATGAT CAGCATGACC TTTATATGAT ATTGATTGTA TGAAATTTGT
GAATCTGCAG GATTACTCAA ACCCATTCGA TCTCTTTGAA TCATTATTCG AAGGCTTTGG TGGAATGGGG GGAATGGGAG
GCCGTGCTGC TCGGAACAGA CCAATGCAGG GTGATGATGA GGCCTACAAT CTGGTACTCA ATTTCAAGGA AGCGGTGTTT
GGTGTAGAGA AAGAAATTGA GATCACCAGA CTGGAAGGCT GTAATACATG TGATGGAACT GGTGCCAAGC CTGGAACGAA
ACCAACCACA TGCAAAACAT GTGGAGGACA GGGACAAGTG GTCTCCTCAA CAAGAACGCC ACTTGGAATA TTCCAGCAGG
TCTCCACCTG CAATACTTGC GGAGGCACTG GTGAATTCTC TACCCCGTGC AACACTTGTG GGGGTGATGG CCGAGTGCGG
AAGACAAAAA GGATCAGTCT AAAGGTTCCT GCTGGTGTTG ATTCTGGAAG CAGATTGAGG GTCCGGTCTG AGGGGAATGC
TGGGCGGAGA GGAGGCCCTC CTGGAGATCT TTATGTGTTT ATTGATGTTC TCTCTGATCC TGTTCTTAAG CGAGATGGGA
CAAACATTCT ATACACATGC AAAGTTTCAT ATATTGACGC AATTCTTGGG ACAACCGTCA AGGTTCCCAC TGTTGATGGG
ATGGTTGACC TGAAGATCCC CTCCGGTACC CAGCCAGGCA CAACGTTAGT GATGTCCAAG AAAGGTGTCC CACTCCTCGG
GAAGTCAAAT GCTCGTGGAG ACCAGCTAGT GCGTGTGCAG GTCGAGATTC CAAAGCGTCT GAGCAGCGAC GAGAGGAAGC
TGATTGAAGA ACTTGCAAAC CTAAACAAGG CTCAAACAGC AAACAGCAGG AGATAATTCC ATGAGGCTTC ATTGGACAAA
ATGCTTTGGC AATATGCAAT TTTAACGCAA ATTGCAGTGA CTAAGTGAGC ATGAACTGGT AAATCACTTC ACAAACTGTA
CGCTCATGCT GCGCCGTACC ATCGGTGGGA ACTGTGAATT CTCATGTCTG TAACTTCATT TTTAAGCCAT AGAAATCTAG
TTCCATCCAA AACACCAAAA CGGATGGTGT TTTACAGTAG CTTGTCATAT GCTTTTAGGC GAGCTTATTA GTCTATTTTT
CATAATACTT TTTCACAATT TTGAAAGGCC TAGGGAGAAA TATTTAATGG TGCAAAAGGG ACGAGTTTTG AAACATTTGT
TTGTCGCAGA AGCACCAGAC CATTCTGATT GTTATTGTAA GCTGTAACAT CAAAGTTTTG GCAGCAGGTT TTCATGTGCT
CTTAAGCGTT GGGGGTTTGT TCCGTTTGGT TT