Os05t0334400-01

Locus

Os05g0334400

Description

Heat shock protein DnaJ family protein, Chloroplast development and differentiation

RAP-DB Gene Symbol Synonym(s)

OsDjA8, OsDjA7/8

RAP-DB Gene Name Synonym(s)

DnaJ domain protein A8, rice DJA7 homolog

CGSNL Gene Symbol

DJA8

CGSNL Gene Name

DNAJ DOMAIN PROTEIN A8

Oryzabase Gene Symbol Synonym(s)

OsDjA8, DjA8

Oryzabase Gene Name Synonym(s)

DnaJ domain protein A8, rice DJA7 homolog

Transcript Evidence

NM_001061765.1

Protein Evidence

Q5W730

Literature

PMID: 26210810

PMID: 23160806

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

August 20, 2015

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Biological Process: response to heat (GO:0009408)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: heat shock protein binding (GO:0031072)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Chaperone DnaJ (IPR012724)

DnaJ domain (IPR001623)

HSP40/DnaJ peptide-binding (IPR008971)

Chaperone DnaJ, C-terminal (IPR002939)

Heat shock protein DnaJ, cysteine-rich domain (IPR001305)

DnaJ domain, conserved site (IPR018253)

Expression Databases

TENOR (Os05t0334400-01)

Others

Oryzabase (12145)

Transcript

1835 bp

>Os05t0334400-01 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
AGCTAGTATATTGAAGGTTGAAGCTTTGTGGGTATCCAGCAAGTATTTCAATGGCGTTGC
TACAGTTTGGAGGTACCTTGGCCCCCAAACTTGGGGAAAAACCTCAGCTGTTGCCCAGGT
CACCTGCACTTACAAGAGTTATTTATGCTGATCCAAGATTTCTGGTGTCGAAAAGTGGTA
GTGGAGGCAGGCTTAAACACCTTGTATCACCTACTGCTAGTTTACAATCACGGACATCTT
CTCGACTATTTAACCATGCACCATCACCGAGATTTCGCCATCGAAGGAGTTCAAGGTTCA
TTGTCAGAGCTGATGCTGATTTCTATTCCACACTTGGTGTTTCAAGAAATGCTAGTAAAT
CTGAAATCAAGAGTGCCTATAGGAAGCTTGCTAGGAGCTACCATCCTGATGTGAACAAAG
ATCCTGGTGCTGAACAAAAGTTCAAGGATATTAGCAATGCTTATGAGGTTTTGTCTGATG
ATGAGAAGCGATCAATCTATGATAAATATGGAGAAGCTGGTTTGAAGGGTGCTGGAATGG
GAACAGGAGATTACTCAAACCCATTCGATCTCTTTGAATCATTATTCGAAGGCTTTGGTG
GAATGGGGGGAATGGGAGGCCGTGCTGCTCGGAACAGACCAATGCAGGGTGATGATGAGG
CCTACAATCTGGTACTCAATTTCAAGGAAGCGGTGTTTGGTGTAGAGAAAGAAATTGAGA
TCACCAGACTGGAAGGCTGTAATACATGTGATGGAACTGGTGCCAAGCCTGGAACGAAAC
CAACCACATGCAAAACATGTGGAGGACAGGGACAAGTGGTCTCCTCAACAAGAACGCCAC
TTGGAATATTCCAGCAGGTCTCCACCTGCAATACTTGCGGAGGCACTGGTGAATTCTCTA
CCCCGTGCAACACTTGTGGGGGTGATGGCCGAGTGCGGAAGACAAAAAGGATCAGTCTAA
AGGTTCCTGCTGGTGTTGATTCTGGAAGCAGATTGAGGGTCCGGTCTGAGGGGAATGCTG
GGCGGAGAGGAGGCCCTCCTGGAGATCTTTATGTGTTTATTGATGTTCTCTCTGATCCTG
TTCTTAAGCGAGATGGGACAAACATTCTATACACATGCAAAGTTTCATATATTGACGCAA
TTCTTGGGACAACCGTCAAGGTTCCCACTGTTGATGGGATGGTTGACCTGAAGATCCCCT
CCGGTACCCAGCCAGGCACAACGTTAGTGATGTCCAAGAAAGGTGTCCCACTCCTCGGGA
AGTCAAATGCTCGTGGAGACCAGCTAGTGCGTGTGCAGGTCGAGATTCCAAAGCGTCTGA
GCAGCGACGAGAGGAAGCTGATTGAAGAACTTGCAAACCTAAACAAGGCTCAAACAGCAA
ACAGCAGGAGATAATTCCATGAGGCTTCATTGGACAAAATGCTTTGGCAATATGCAATTT
TAACGCAAATTGCAGTGACTAAGTGAGCATGAACTGGTAAATCACTTCACAAACTGTACG
CTCATGCTGCGCCGTACCATCGGTGGGAACTGTGAATTCTCATGTCTGTAACTTCATTTT
TAAGCCATAGAAATCTAGTTCCATCCAAAACACCAAAACGGATGGTGTTTTACAGTAGCT
TGTCATATGCTTTTAGGCGAGCTTATTAGTCTATTTTTCATAATACTTTTTCACAATTTT
GAAAGGCCTAGGGAGAAATATTTAATGGTGCAAAAGGGACGAGTTTTGAAACATTTGTTT
GTCGCAGAAGCACCAGACCATTCTGATTGTTATTGTAAGCTGTAACATCAAAGTTTTGGC
AGCAGGTTTTCATGTGCTCTTAAGCGTTGGGGGTT

CDS

1344 bp

>Os05t0334400-01 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
ATGGCGTTGCTACAGTTTGGAGGTACCTTGGCCCCCAAACTTGGGGAAAAACCTCAGCTG
TTGCCCAGGTCACCTGCACTTACAAGAGTTATTTATGCTGATCCAAGATTTCTGGTGTCG
AAAAGTGGTAGTGGAGGCAGGCTTAAACACCTTGTATCACCTACTGCTAGTTTACAATCA
CGGACATCTTCTCGACTATTTAACCATGCACCATCACCGAGATTTCGCCATCGAAGGAGT
TCAAGGTTCATTGTCAGAGCTGATGCTGATTTCTATTCCACACTTGGTGTTTCAAGAAAT
GCTAGTAAATCTGAAATCAAGAGTGCCTATAGGAAGCTTGCTAGGAGCTACCATCCTGAT
GTGAACAAAGATCCTGGTGCTGAACAAAAGTTCAAGGATATTAGCAATGCTTATGAGGTT
TTGTCTGATGATGAGAAGCGATCAATCTATGATAAATATGGAGAAGCTGGTTTGAAGGGT
GCTGGAATGGGAACAGGAGATTACTCAAACCCATTCGATCTCTTTGAATCATTATTCGAA
GGCTTTGGTGGAATGGGGGGAATGGGAGGCCGTGCTGCTCGGAACAGACCAATGCAGGGT
GATGATGAGGCCTACAATCTGGTACTCAATTTCAAGGAAGCGGTGTTTGGTGTAGAGAAA
GAAATTGAGATCACCAGACTGGAAGGCTGTAATACATGTGATGGAACTGGTGCCAAGCCT
GGAACGAAACCAACCACATGCAAAACATGTGGAGGACAGGGACAAGTGGTCTCCTCAACA
AGAACGCCACTTGGAATATTCCAGCAGGTCTCCACCTGCAATACTTGCGGAGGCACTGGT
GAATTCTCTACCCCGTGCAACACTTGTGGGGGTGATGGCCGAGTGCGGAAGACAAAAAGG
ATCAGTCTAAAGGTTCCTGCTGGTGTTGATTCTGGAAGCAGATTGAGGGTCCGGTCTGAG
GGGAATGCTGGGCGGAGAGGAGGCCCTCCTGGAGATCTTTATGTGTTTATTGATGTTCTC
TCTGATCCTGTTCTTAAGCGAGATGGGACAAACATTCTATACACATGCAAAGTTTCATAT
ATTGACGCAATTCTTGGGACAACCGTCAAGGTTCCCACTGTTGATGGGATGGTTGACCTG
AAGATCCCCTCCGGTACCCAGCCAGGCACAACGTTAGTGATGTCCAAGAAAGGTGTCCCA
CTCCTCGGGAAGTCAAATGCTCGTGGAGACCAGCTAGTGCGTGTGCAGGTCGAGATTCCA
AAGCGTCTGAGCAGCGACGAGAGGAAGCTGATTGAAGAACTTGCAAACCTAAACAAGGCT
CAAACAGCAAACAGCAGGAGATAA

Protein

448 aa

>Os05t0334400-01 Heat shock protein DnaJ family protein, Chloroplast development and differentiation
MALLQFGGTLAPKLGEKPQLLPRSPALTRVIYADPRFLVSKSGSGGRLKHLVSPTASLQS
RTSSRLFNHAPSPRFRHRRSSRFIVRADADFYSTLGVSRNASKSEIKSAYRKLARSYHPD
VNKDPGAEQKFKDISNAYEVLSDDEKRSIYDKYGEAGLKGAGMGTGDYSNPFDLFESLFE
GFGGMGGMGGRAARNRPMQGDDEAYNLVLNFKEAVFGVEKEIEITRLEGCNTCDGTGAKP
GTKPTTCKTCGGQGQVVSSTRTPLGIFQQVSTCNTCGGTGEFSTPCNTCGGDGRVRKTKR
ISLKVPAGVDSGSRLRVRSEGNAGRRGGPPGDLYVFIDVLSDPVLKRDGTNILYTCKVSY
IDAILGTTVKVPTVDGMVDLKIPSGTQPGTTLVMSKKGVPLLGKSNARGDQLVRVQVEIP
KRLSSDERKLIEELANLNKAQTANSRR*

5'UTR

chr05:15638468..15638517 (- strand) : 50 bp

CDS

chr05:15638340..15638467 (- strand) : 128 bp

chr05:15638080..15638218 (- strand) : 139 bp

chr05:15637936..15637993 (- strand) : 58 bp

chr05:15637146..15637188 (- strand) : 43 bp

chr05:15636932..15636980 (- strand) : 49 bp

chr05:15636754..15636834 (- strand) : 81 bp

chr05:15635818..15636663 (- strand) : 846 bp

3'UTR

chr05:15635377..15635817 (- strand) : 441 bp

FASTA

>Os05t0334400-01 class=Sequence position=chr05:15635377..15638517 (- strand)
AGCTAGTATA TTGAAGGTTG AAGCTTTGTG GGTATCCAGC AAGTATTTCA ATGGCGTTGC TACAGTTTGG AGGTACCTTG
GCCCCCAAAC TTGGGGAAAA ACCTCAGCTG TTGCCCAGGT CACCTGCACT TACAAGAGTT ATTTATGCTG ATCCAAGATT
TCTGGTGTCG AAAAGTGGGT ATGTGAATGT GTTCTGATCA GTGAGATGTA CTAGGAATAC TAAAATAAAG GACACATTGA
TATTATAAAA AGGCAAGATT TCTGAGTAAA CTGAAGATGA TATATCTCTT TTTGTGCAGT AGTGGAGGCA GGCTTAAACA
CCTTGTATCA CCTACTGCTA GTTTACAATC ACGGACATCT TCTCGACTAT TTAACCATGC ACCATCACCG AGATTTCGCC
ATCGAAGGAG TTCAAGGTTC ATTGTCAGAG CTGATGCTGT GAGTTACTTC ATTTGCTTTT CTTCTTTGCT GGTATTATTA
GAAAATCCAG TTTCCTGACA TGGATTTGAT ATTTTAATTT ACAGGATTTC TATTCCACAC TTGGTGTTTC AAGAAATGCT
AGTAAATCTG AAATCAAGAG TGGTAGGTGT GGTTTTATTT GTCAGTTTAG GGCATGCAGT GATTGGTGCT CCGTACAATC
GTAGGAGTAT TACCCAGCTT TGCTTCTTCT CTAGTTTGAG CCTGGTTGTA GGTTTGTAGG TACCCTATAA TTTACCAAAC
AAACCAGACT GCTTTCATGT GGCTATTAGT CGTAGATTAC TAGTTTTAAA TCATACTGTT CACGTGTGAA ACAAAATATA
TGTACAACAG AAACTGTTAA GCTTCCCAGG GAAGATATGA AATATATAAC TAGTCTTTTT CAAACTTGGC CATAGTGAGC
TTTATGGCCC ACTTGTTTGT TCTCGAAAGC TTTACTATTC CTACTAGTAA CTCAAATATT TGCTATTTCA TCTAATTTGA
AGGCTATCTC AGCAAAACCC CTTGAACTAT TCTAAGACAA GCCTATGCTG TCTTCAGTAT CATTTTCTGC AACTGATCAT
CTTGCGTTCT AGACTCGATA CTGTTTATAT TTCTGAAAAT CTATTGTTGG CAACTTCTCA TTGATGCATT GTTTGTATGG
CCCTCAATCC CTGCCCTCCA CGTGTGTGGG CAGAAATTTT GAACAAAAAT CCCAACCCAC ACCCGTAGAT AATCTAGGAT
TTGTCCTATC CAAATAATGC CTAAGGGGAT ATTATGTTAG AAATCCTTCA GAGTCAATTT TGATCAAAAT ATGTGTAGTA
GTTTAATGTT GCTTTCTATT GTAGTTCTAA AATGGTCCTT CTTTTCCAGC CTATAGGAAG CTTGCTAGGA GCTACCATCC
TGATGTGAAC AAGTAAGTAC TAACCATTAT ATGGGAATTG TGTTTCAGCT ACACTCGATA TATTGCTTCT TTTTCTCCTT
TCGATCCATT ATAAACCTGA GTACTAGTTG TTGCATTACC TTTTTCATAA CTACATAATC AAATAAGCAA TTGTTATGCT
TGTGTATTTT TCTTTAGAGA TCCTGGTGCT GAACAAAAGT TCAAGGATAT TAGCAATGCT TATGAGGTTA GTCCAGCTAA
CCATAACCAA ATCCCATTGT TTCTTATGAC TATGTTGTTG TAGGGTTACA GGTGCTTGCC AGCTAACATA AATAGGATTG
CAGGTTTTGT CTGATGATGA GAAGCGATCA ATCTATGATA AATATGGAGA AGCTGGTTTG AAGGGTGCTG GAATGGGAAC
AGGAGTGAGT GTTCCTAGAA TGTTGTCCAA TTCTGAAGTA TGATCAGCAT GACCTTTATA TGATATTGAT TGTATGAAAT
TTGTGAATCT GCAGGATTAC TCAAACCCAT TCGATCTCTT TGAATCATTA TTCGAAGGCT TTGGTGGAAT GGGGGGAATG
GGAGGCCGTG CTGCTCGGAA CAGACCAATG CAGGGTGATG ATGAGGCCTA CAATCTGGTA CTCAATTTCA AGGAAGCGGT
GTTTGGTGTA GAGAAAGAAA TTGAGATCAC CAGACTGGAA GGCTGTAATA CATGTGATGG AACTGGTGCC AAGCCTGGAA
CGAAACCAAC CACATGCAAA ACATGTGGAG GACAGGGACA AGTGGTCTCC TCAACAAGAA CGCCACTTGG AATATTCCAG
CAGGTCTCCA CCTGCAATAC TTGCGGAGGC ACTGGTGAAT TCTCTACCCC GTGCAACACT TGTGGGGGTG ATGGCCGAGT
GCGGAAGACA AAAAGGATCA GTCTAAAGGT TCCTGCTGGT GTTGATTCTG GAAGCAGATT GAGGGTCCGG TCTGAGGGGA
ATGCTGGGCG GAGAGGAGGC CCTCCTGGAG ATCTTTATGT GTTTATTGAT GTTCTCTCTG ATCCTGTTCT TAAGCGAGAT
GGGACAAACA TTCTATACAC ATGCAAAGTT TCATATATTG ACGCAATTCT TGGGACAACC GTCAAGGTTC CCACTGTTGA
TGGGATGGTT GACCTGAAGA TCCCCTCCGG TACCCAGCCA GGCACAACGT TAGTGATGTC CAAGAAAGGT GTCCCACTCC
TCGGGAAGTC AAATGCTCGT GGAGACCAGC TAGTGCGTGT GCAGGTCGAG ATTCCAAAGC GTCTGAGCAG CGACGAGAGG
AAGCTGATTG AAGAACTTGC AAACCTAAAC AAGGCTCAAA CAGCAAACAG CAGGAGATAA TTCCATGAGG CTTCATTGGA
CAAAATGCTT TGGCAATATG CAATTTTAAC GCAAATTGCA GTGACTAAGT GAGCATGAAC TGGTAAATCA CTTCACAAAC
TGTACGCTCA TGCTGCGCCG TACCATCGGT GGGAACTGTG AATTCTCATG TCTGTAACTT CATTTTTAAG CCATAGAAAT
CTAGTTCCAT CCAAAACACC AAAACGGATG GTGTTTTACA GTAGCTTGTC ATATGCTTTT AGGCGAGCTT ATTAGTCTAT
TTTTCATAAT ACTTTTTCAC AATTTTGAAA GGCCTAGGGA GAAATATTTA ATGGTGCAAA AGGGACGAGT TTTGAAACAT
TTGTTTGTCG CAGAAGCACC AGACCATTCT GATTGTTATT GTAAGCTGTA ACATCAAAGT TTTGGCAGCA GGTTTTCATG
TGCTCTTAAG CGTTGGGGGT T

Locus: Os05g0334400

Loading...

Locus: Os05g0334400

Loading...