Os05t0334750-00

Locus

Os05g0334750

Description

Similar to CBL-interacting protein kinase 22.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK22

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 22

Oryzabase Gene Symbol Synonym(s)

OsCIPK22, OsSnRK3.17, SnRK3.17

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 22, Sucrose nonfermenting-1-related protein kinase 3.17

Transcript Evidence

FP091734 (DDBJ)

Protein Evidence

Q5KQF5 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

NAF/FISL domain (IPR018451)

Expression Databases

TENOR (Os05t0334750-00)

Others

Oryzabase (7409)

Transcript

1424 bp

>Os05t0334750-00 Similar to CBL-interacting protein kinase 22.
AAACTACTCTCCATCAAATCATCAAACCAAACACCACTACTTTCCTCTCCAACTTCACGA
CGCCGGAGATGCCACCGGCCGGCGACGACGAGTCGCCGGCGGCCACCGGCGACGGCTACT
CGAAGAAGGTCCTGCAGGGCCGGTACGAGCTCGGCCGCGTGCTCGGCCAGGGCGCCTCCT
CCAAGGTGTACCGCGCGCGCGACGCCCGCACGGGCGCCCACGTCGCCGTCAAGGCCATCC
GCAAGCAGCAGCAGCCGCACCACCACCCGTCGTGCCGCTCGCCCGAGGCGGCCGCCGCGG
CGCGGAGGTGCGTGGAGGTGGAGCGGGAGGTCGCCGCGCTCCGCCGCGTGCGCGGCCACC
CGCACGTGGTGGCGCTCCTCGACGTGCTCGCCACCCGCTCCACCGTCTACCTCGTCCTCG
AGCTCGCCAGCGGCGGCAGCGTCCTGTCCGCGCTCGACAGCCGCGGCGGCGGCCACTACG
ACGAGCCCGCGGCGCGCCGCCTGTTCGCGCAGCTGGCCTCCGCGGTGGCGCACGCGCACT
CCCTCGGCGTGTTCCATCGCGACATCAAGCCGGAGAACCTCCTCCTCGACGAGCGCGGCG
ACCTCCGGCTCACGGACTTCGGGCTCAGCGCGTTCGCCGACGCCGACCAGCACCTCGGCG
CCACAGACGGCCTCGCCGCCACGCACTGCGGCTCCCCGGCCTACGTCGCGCCGGAGATCC
TCCTGAAGCGGCGGTACGACGCCAGCAAGGCGGACGTGTGGTCCTGCGGCGTCGTGCTCT
TCGTGCTCACCGCCGGCTACCTGCCGTTCAACGACGGCAACCTCATGGCCATGTACCGGA
AGATCTGCGCCGCTAAGTTCCGGTGTCCAAAATGGTGCTCGCAGGAGCTCCGCTCCCTTA
TCGGGCGGATGCTTGACCCGGAACCCGATACCCGCATCAAGATTGGTGAAATCTTCGATC
ACCCTTGGCTCCAACAAGATGGGAGTTCATCATCATTCGGTATGATCCAAGCTGCGTCCT
CTCATTCTAAACCAGAGGTAGAGAAATGGGAGGCTGAATTGGAGCAAGCAATGGAGCTAA
ATGCTTTCGACATAATCGGGTTCGCCTCGGGATGCGATCTAAGCGGGTTGATCGGTCCAT
TGCCAGATCGAGTTCGATTCGTCTTGCCGGGTGGGGATTCCAAGTCAGTTCTGGACAAAG
TTGAGAAGCTAGGGCGAGAGGAAGGGCTTGTAGTGAGGAGGAAAGAGGAAGAATGGTGTG
GAGGAGTTCATGTAGAGGCAACTAGTGGGAAATTCACTGCATATGTGAGGGTTAATCTAT
TGCCCAAGAAAATACTGATGATAGAGGCTGAAAGGGTTATTGGAAGCGAGATTCCTAAAT
TTTGGCATCAACTTCAGATTGGTAATCTATTAGTAAGAAAATGA

CDS

1356 bp

>Os05t0334750-00 Similar to CBL-interacting protein kinase 22.
ATGCCACCGGCCGGCGACGACGAGTCGCCGGCGGCCACCGGCGACGGCTACTCGAAGAAG
GTCCTGCAGGGCCGGTACGAGCTCGGCCGCGTGCTCGGCCAGGGCGCCTCCTCCAAGGTG
TACCGCGCGCGCGACGCCCGCACGGGCGCCCACGTCGCCGTCAAGGCCATCCGCAAGCAG
CAGCAGCCGCACCACCACCCGTCGTGCCGCTCGCCCGAGGCGGCCGCCGCGGCGCGGAGG
TGCGTGGAGGTGGAGCGGGAGGTCGCCGCGCTCCGCCGCGTGCGCGGCCACCCGCACGTG
GTGGCGCTCCTCGACGTGCTCGCCACCCGCTCCACCGTCTACCTCGTCCTCGAGCTCGCC
AGCGGCGGCAGCGTCCTGTCCGCGCTCGACAGCCGCGGCGGCGGCCACTACGACGAGCCC
GCGGCGCGCCGCCTGTTCGCGCAGCTGGCCTCCGCGGTGGCGCACGCGCACTCCCTCGGC
GTGTTCCATCGCGACATCAAGCCGGAGAACCTCCTCCTCGACGAGCGCGGCGACCTCCGG
CTCACGGACTTCGGGCTCAGCGCGTTCGCCGACGCCGACCAGCACCTCGGCGCCACAGAC
GGCCTCGCCGCCACGCACTGCGGCTCCCCGGCCTACGTCGCGCCGGAGATCCTCCTGAAG
CGGCGGTACGACGCCAGCAAGGCGGACGTGTGGTCCTGCGGCGTCGTGCTCTTCGTGCTC
ACCGCCGGCTACCTGCCGTTCAACGACGGCAACCTCATGGCCATGTACCGGAAGATCTGC
GCCGCTAAGTTCCGGTGTCCAAAATGGTGCTCGCAGGAGCTCCGCTCCCTTATCGGGCGG
ATGCTTGACCCGGAACCCGATACCCGCATCAAGATTGGTGAAATCTTCGATCACCCTTGG
CTCCAACAAGATGGGAGTTCATCATCATTCGGTATGATCCAAGCTGCGTCCTCTCATTCT
AAACCAGAGGTAGAGAAATGGGAGGCTGAATTGGAGCAAGCAATGGAGCTAAATGCTTTC
GACATAATCGGGTTCGCCTCGGGATGCGATCTAAGCGGGTTGATCGGTCCATTGCCAGAT
CGAGTTCGATTCGTCTTGCCGGGTGGGGATTCCAAGTCAGTTCTGGACAAAGTTGAGAAG
CTAGGGCGAGAGGAAGGGCTTGTAGTGAGGAGGAAAGAGGAAGAATGGTGTGGAGGAGTT
CATGTAGAGGCAACTAGTGGGAAATTCACTGCATATGTGAGGGTTAATCTATTGCCCAAG
AAAATACTGATGATAGAGGCTGAAAGGGTTATTGGAAGCGAGATTCCTAAATTTTGGCAT
CAACTTCAGATTGGTAATCTATTAGTAAGAAAATGA

Protein

451 aa

>Os05t0334750-00 Similar to CBL-interacting protein kinase 22.
MPPAGDDESPAATGDGYSKKVLQGRYELGRVLGQGASSKVYRARDARTGAHVAVKAIRKQ
QQPHHHPSCRSPEAAAAARRCVEVEREVAALRRVRGHPHVVALLDVLATRSTVYLVLELA
SGGSVLSALDSRGGGHYDEPAARRLFAQLASAVAHAHSLGVFHRDIKPENLLLDERGDLR
LTDFGLSAFADADQHLGATDGLAATHCGSPAYVAPEILLKRRYDASKADVWSCGVVLFVL
TAGYLPFNDGNLMAMYRKICAAKFRCPKWCSQELRSLIGRMLDPEPDTRIKIGEIFDHPW
LQQDGSSSSFGMIQAASSHSKPEVEKWEAELEQAMELNAFDIIGFASGCDLSGLIGPLPD
RVRFVLPGGDSKSVLDKVEKLGREEGLVVRRKEEEWCGGVHVEATSGKFTAYVRVNLLPK
KILMIEAERVIGSEIPKFWHQLQIGNLLVRK*

5'UTR

chr05:15644665..15644732 (- strand) : 68 bp

CDS

chr05:15643309..15644664 (- strand) : 1356 bp

FASTA

>Os05t0334750-00 class=Sequence position=chr05:15643309..15644732 (- strand)
AAACTACTCT CCATCAAATC ATCAAACCAA ACACCACTAC TTTCCTCTCC AACTTCACGA CGCCGGAGAT GCCACCGGCC
GGCGACGACG AGTCGCCGGC GGCCACCGGC GACGGCTACT CGAAGAAGGT CCTGCAGGGC CGGTACGAGC TCGGCCGCGT
GCTCGGCCAG GGCGCCTCCT CCAAGGTGTA CCGCGCGCGC GACGCCCGCA CGGGCGCCCA CGTCGCCGTC AAGGCCATCC
GCAAGCAGCA GCAGCCGCAC CACCACCCGT CGTGCCGCTC GCCCGAGGCG GCCGCCGCGG CGCGGAGGTG CGTGGAGGTG
GAGCGGGAGG TCGCCGCGCT CCGCCGCGTG CGCGGCCACC CGCACGTGGT GGCGCTCCTC GACGTGCTCG CCACCCGCTC
CACCGTCTAC CTCGTCCTCG AGCTCGCCAG CGGCGGCAGC GTCCTGTCCG CGCTCGACAG CCGCGGCGGC GGCCACTACG
ACGAGCCCGC GGCGCGCCGC CTGTTCGCGC AGCTGGCCTC CGCGGTGGCG CACGCGCACT CCCTCGGCGT GTTCCATCGC
GACATCAAGC CGGAGAACCT CCTCCTCGAC GAGCGCGGCG ACCTCCGGCT CACGGACTTC GGGCTCAGCG CGTTCGCCGA
CGCCGACCAG CACCTCGGCG CCACAGACGG CCTCGCCGCC ACGCACTGCG GCTCCCCGGC CTACGTCGCG CCGGAGATCC
TCCTGAAGCG GCGGTACGAC GCCAGCAAGG CGGACGTGTG GTCCTGCGGC GTCGTGCTCT TCGTGCTCAC CGCCGGCTAC
CTGCCGTTCA ACGACGGCAA CCTCATGGCC ATGTACCGGA AGATCTGCGC CGCTAAGTTC CGGTGTCCAA AATGGTGCTC
GCAGGAGCTC CGCTCCCTTA TCGGGCGGAT GCTTGACCCG GAACCCGATA CCCGCATCAA GATTGGTGAA ATCTTCGATC
ACCCTTGGCT CCAACAAGAT GGGAGTTCAT CATCATTCGG TATGATCCAA GCTGCGTCCT CTCATTCTAA ACCAGAGGTA
GAGAAATGGG AGGCTGAATT GGAGCAAGCA ATGGAGCTAA ATGCTTTCGA CATAATCGGG TTCGCCTCGG GATGCGATCT
AAGCGGGTTG ATCGGTCCAT TGCCAGATCG AGTTCGATTC GTCTTGCCGG GTGGGGATTC CAAGTCAGTT CTGGACAAAG
TTGAGAAGCT AGGGCGAGAG GAAGGGCTTG TAGTGAGGAG GAAAGAGGAA GAATGGTGTG GAGGAGTTCA TGTAGAGGCA
ACTAGTGGGA AATTCACTGC ATATGTGAGG GTTAATCTAT TGCCCAAGAA AATACTGATG ATAGAGGCTG AAAGGGTTAT
TGGAAGCGAG ATTCCTAAAT TTTGGCATCA ACTTCAGATT GGTAATCTAT TAGTAAGAAA ATGA

Locus: Os05g0334750

Loading...

Locus: Os05g0334750

Loading...