Os05t0356201-00

Locus

Os05g0356201

Description

Similar to LIPLESS2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AP2/EREBP92

CGSNL Gene Name

APETALA2/ETHYLENE-RESPONSIVE ELEMENT BINDING PROTEIN 92

Oryzabase Gene Symbol Synonym(s)

AP2/EREBP#092

Oryzabase Gene Name Synonym(s)

APETALA2/ethylene-responsive element binding protein 92

Transcript Evidence

AJ577368 (DDBJ)

Protein Evidence

Q84U23 (UniProt)

Literature

Note

Manual Curation

Expression Databases

TENOR (Os05t0356201-00)

Others

Oryzabase (10659)

KEGG (Os05t0356201-00)

Transcript

567 bp

>Os05t0356201-00 Similar to LIPLESS2.
ATGGTGTGGCGACGTGGTGGCGGCGGGCTGGGCGCAGGCGGGCGACGCGACGCCCAATCC
GACGCGGGCCGCGGTCGCGCAGCTCGCAGTACTGCGGCGTCAAGTTCTACCGCCGCACCG
GGCGATGGGAATCGCACATATGGTAAGCCTCCTCGTCTCCTGCTCGTTCTTTCCATTTTC
GAGAGCTCAACGAAGGAGGAAGGAGGAGAGAGAGGCAAGGGGAGCAAAAGAAGAGCAGCA
TGGACGGGTTTGGTATTGGATTCGTCTTGTTTTGGGCATTTCTCGCTTCTGCTCCTTTTA
CCTTTGTTTTTCTGCTCCTTTCCCAATCGCAGGACGTACGATCTAGCGGCGATCAAGTTC
CGCGGCGTGGAGGGCTGGAGGCCGACATCAATTTCAGCTTGGAGGATTATGGGGGATGAT
CTGAAGCAGGTGAGAACAAGTTTAACGAGATCATTGTGGATGAGCAATCTGACCAAGGAG
GAGTTCGTCCACGTGCTCCGGCGGTAGAGCACAGGGTTCCCCCGGGGAAGCTCCAAGTAG
AGGGGCGTGAgctgcgccgtgggcgcc

CDS

507 bp

>Os05t0356201-00 Similar to LIPLESS2.
ATGGTGTGGCGACGTGGTGGCGGCGGGCTGGGCGCAGGCGGGCGACGCGACGCCCAATCC
GACGCGGGCCGCGGTCGCGCAGCTCGCAGTACTGCGGCGTCAAGTTCTACCGCCGCACCG
GGCGATGGGAATCGCACATATGGTAAGCCTCCTCGTCTCCTGCTCGTTCTTTCCATTTTC
GAGAGCTCAACGAAGGAGGAAGGAGGAGAGAGAGGCAAGGGGAGCAAAAGAAGAGCAGCA
TGGACGGGTTTGGTATTGGATTCGTCTTGTTTTGGGCATTTCTCGCTTCTGCTCCTTTTA
CCTTTGTTTTTCTGCTCCTTTCCCAATCGCAGGACGTACGATCTAGCGGCGATCAAGTTC
CGCGGCGTGGAGGGCTGGAGGCCGACATCAATTTCAGCTTGGAGGATTATGGGGGATGAT
CTGAAGCAGGTGAGAACAAGTTTAACGAGATCATTGTGGATGAGCAATCTGACCAAGGAG
GAGTTCGTCCACGTGCTCCGGCGGTAG

Protein

169 aa

>Os05t0356201-00 Similar to LIPLESS2.
MVWRRGGGGLGAGGRRDAQSDAGRGRAARSTAASSSTAAPGDGNRTYGKPPRLLLVLSIF
ESSTKEEGGERGKGSKRRAAWTGLVLDSSCFGHFSLLLLLPLFFCSFPNRRTYDLAAIKF
RGVEGWRPTSISAWRIMGDDLKQVRTSLTRSLWMSNLTKEEFVHVLRR*

CDS

chr05:16885866..16886372 (- strand) : 507 bp

3'UTR

chr05:16885806..16885865 (- strand) : 60 bp

FASTA

>Os05t0356201-00 class=Sequence position=chr05:16885806..16886372 (- strand)
ATGGTGTGGC GACGTGGTGG CGGCGGGCTG GGCGCAGGCG GGCGACGCGA CGCCCAATCC GACGCGGGCC GCGGTCGCGC
AGCTCGCAGT ACTGCGGCGT CAAGTTCTAC CGCCGCACCG GGCGATGGGA ATCGCACATA TGGTAAGCCT CCTCGTCTCC
TGCTCGTTCT TTCCATTTTC GAGAGCTCAA CGAAGGAGGA AGGAGGAGAG AGAGGCAAGG GGAGCAAAAG AAGAGCAGCA
TGGACGGGTT TGGTATTGGA TTCGTCTTGT TTTGGGCATT TCTCGCTTCT GCTCCTTTTA CCTTTGTTTT TCTGCTCCTT
TCCCAATCGC AGGACGTACG ATCTAGCGGC GATCAAGTTC CGCGGCGTGG AGGGCTGGAG GCCGACATCA ATTTCAGCTT
GGAGGATTAT GGGGGATGAT CTGAAGCAGG TGAGAACAAG TTTAACGAGA TCATTGTGGA TGAGCAATCT GACCAAGGAG
GAGTTCGTCC ACGTGCTCCG GCGGTAGAGC ACAGGGTTCC CCCGGGGAAG CTCCAAGTAG AGGGGCGTGA gctgcgccgt
gggcgcc