Os05t0358000-01

Locus

Os05g0358000

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-2

Oryzabase Gene Name Synonym(s)

drought-induced 19-2

Transcript Evidence

AK070900 (DDBJ, Best hit)

Protein Evidence

B9FP47 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J023073C10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0358000-01)

Others

Oryzabase (18577)

Transcript

3330 bp

>Os05t0358000-01 Conserved hypothetical protein.
AGCAGATCAGCAATATCAGAGAAGCCAGCAAAGACGTGCGTCGCCGACGGAATCTGTTGT
GTGTGTGTCCACCCAATTTGCTGCTCGTGTGTGTTCTCCCGTGAGTTTGTTGCTTACGTG
AGTTTGTGATTTTCTTGGGCCAAAGCTAACAGAGCCCACGACAGCGCCTGGGGCGAGGGA
CGACAGCACGCGGAAGGCCTCCTGTAGCCCGTTGACCTCGCGCCTCCTGGTCATCGACGC
CGCCCAAGGCACCATGCCCACTGGATTTGTGCGTGACGAGGCCAAGGGAGGCAAATCTGG
TGGCGTCGCGCCCCTCCGCCGCCCGGCGGCACATGTCCCGTGCTCCTTCACCGCTAGGAG
TGCTTCGAGCAAGAATAGGGGTGGAGGAGTGCTCGCGACAAGAAGTCTACGAAAAGGCAC
CGACACCGGCGAGAGGTGGCAAGAAGTGCTGTAACGCATGTCTTTCAGGCTCTCATCACT
CACCTCTCGTCTCGCTAGCAATGTCACACCAAATCCTCAACACCTCAGCACACATTCACC
ACCGCGCCCTGCATCGGCGACTTGCCAGTCACGGCCAAGCCTTCCAGGATGTTAGCAGGG
AAAATCACCATTGGCCTCTTCGGCGACGAGGTCCCCGCCGGTGCGTCCCGGCTCCTGTCG
CTTGGTGTCGGCTAGTTAAGATAGTGTGGGGCTACATGCAAGCAGGACGGTGTGGTGTCA
CACCCGGCCATCCCGGCGCTGACCGACCGGCTAGCGGCGAAGATGGACGCCGCACGCGCG
CGCAATGCGATGGGGACAGGAGTGGCGTCCACCCAACTCCCACGGCATATGGTGACGGCC
GGCGAGGCAGCGGCGGCTGAACAACTGAGCTTCTAGCTTCCGTCGAGGAAGAAGCGACCG
AACGGGAGAGGGAGAGAGAGAGGAGGAAGAGAGAAGCGAGGAAAAAGAAAAAAAAACAAA
TAAGTGCCACGTAGGACATGTGGGGTTATTGTTTTTTCTTTTCACTGACATGCGGGTCCC
CTAAGTGCCACATAGGATGAAACCGCTATCAAACAGCCGAGGGACTCAATCTGCTctggt
tttcaaagatggaggagacgttatacccggtattgcgattgagggaggttatttaatcag
gggcaagagttgagggaggcaatttatacttattccttacaAGGCAGGGTCCGACATTTC
CAGCCCAAAAGAATCGGACCCATTTATTCGGCCCAATCTGGCCCATGCTCGGGGCCTAGT
TTTTCCAGGTAAAGTTGACCAAAAGTCTTCACCTAGTCGTCGTCTTCCCTCGGCCGGCCT
GACCATGAAAATAAACGCTACCCAACGACTCCGCAGTCACCTCACCACACGTCGATGGAC
ACGGCGCACCAGTGAACCCCCTCGGCCCCACCAACCACCACCACCATCAACATCCTACCT
TACCTCTCTCTGGCAACCGGGTCCCACCTAAGGTCCACGCTACACCCGGTCCACCAACAC
CCGTGGGCCCCACCGCTCTCTCGTCGTCGCACCGACCCCAACCGAAGCGGTAACAAAGCC
AACGTCCCACCACCACCACACGCGCGCGCTCGCACAGACACACACACAGCACAGCGGAGA
AAGAGAGAGAGAGAGAGAGAAAGGAAAAATCGGCACCACCGCGAAAGGGGGAAAAGGGGG
GAAGGAAGCGAGGCGAGGCTAGGGTTTCGATTCGATCCCGCCGCTGCCATGGACGCCGGT
GATGCGTGGGGCCGCTCCTCCTCCTCATCCTCCTCCGCCGCCGCCGCCGCCAGGCGCCTG
CAGGCGCGCTACGGTAAGCTCACACGACGACGGGTCGGCTTTCTCTCGATCCATCGGTCG
ATCTCCCCAGCTGTTGGATTGCCATGGGCTGCGATTTGATGCGTGGGTGGTGGTGGTGGA
TGTGTGTGGGTGTTGGCTCAGATCTGTACATGGGGTTCGACGACGCGGACGCGGCGGGCG
TGGAGGAGGTGGAGGCGCGCGGCGGCGGGGAGGCGTACAACTGCCCCTTCTGCGGCGAGG
ACTTCGACTTCGTCGCCTTCTGCTGCCACGTCGACGACGAGCACGCCGTCGAGGCCAAGA
GCGGGGTATATGCCACATCCTCCCATCTGACACCGATTGTAACCGTCAGTATCAGATTGT
TGTGTTTGTGATTGGTTGGATACTTGGACCGGGCCTTGGTTTCGGAAATGTGCAATTCGT
AGGCACGCGTGCAAATTTTTTTTTTAGAACAGGATGCCTCCGCAGGTATCAACAGATTTC
AACTGTGACGAACCAAGACCAGCGAAAGCTTGCAGGTTTTAGGAGTTGGAATTTTGGACT
TTTTGGTTGGAGTTATAAGATTGGTTGTTTTGGGGTTTGGGTAGGTGTCTTCGTTTGCTT
GATTGGAGAAAAATAATTCGTAGTGGCTATCCATGTCGGGGAGAATGATTGATTTTAATT
TTGGGGGGTTTAGTTGGGGACTTGAGTTTTTTCTGTCTTTTGGGGGGAGTTTGGGACTGG
CGGAAAACATTTCTTGTGTTGTTCATGCTAGTCATTAGCCTATTACACTCTACTGTAGTT
TTTATTTATTTTCTTTCTTGTTCTTAGTATCTGATGAAATATGTTCTCTCAGCTTTCTTT
ATTTTTTGTAAATCTGTGGTCATTTTGCAGCTATTAAGATCCCAGCTCTATTCTCTCCAG
ATTATAAAGCACATCAGCACTTGTTTCTCTTGAAAGTGAAACATCCATACCAAACTGACA
ATATTACATATTTTCATTTCAATCTAACAATATTACATATTTTCATTCAATCTAACAATA
TGATGATTGTTCTTGGCTTGGTGGTTAGGATTATTATTTGTCTATGGAAGAAAAGAGTGG
TACTAACTAGTGATCACTTTATGTTTTGTGATTGGGACTTGTTCATGATTAATAGTGGGA
TTCAGTACAACTTATTACAATATCCTTTATGAACTAGTTCACCAGTTCCCTTGCTTCGAT
CACAAAAATGGGCATAACTTTTCTTTGTTTTGTCTTAGGTGGTGAAGCTCATTGAAATTG
CAGGAATTTTCATGTTTTATTGCTTTCGTAGGATCGTTTACATTATATTTGGATTTGTGA
GATACACCCTTTGATTAATATTTGAAATTATGATGGTGCTTGGATACGAGGGAAGGAAGT
TTAGATGGTTACTGGTATTGTTTTATCTGGTGCTGGTTTAGGAAATTCTCTTTTATCTAT
TTCTATTTTCTAAGATGTTTTTCTCAGATATTGGTTGTTAGTTCTGACCATCTTTTGTAA
ATAAAAATAACAGCTTTTGTCTGTTGTATC

CDS

333 bp

>Os05t0358000-01 Conserved hypothetical protein.
GTTTGTGATTTTCTTGGGCCAAAGCTAACAGAGCCCACGACAGCGCCTGGGGCGAGGGAC
GACAGCACGCGGAAGGCCTCCTGTAGCCCGTTGACCTCGCGCCTCCTGGTCATCGACGCC
GCCCAAGGCACCATGCCCACTGGATTTGTGCGTGACGAGGCCAAGGGAGGCAAATCTGGT
GGCGTCGCGCCCCTCCGCCGCCCGGCGGCACATGTCCCGTGCTCCTTCACCGCTAGGAGT
GCTTCGAGCAAGAATAGGGGTGGAGGAGTGCTCGCGACAAGAAGTCTACGAAAAGGCACC
GACACCGGCGAGAGGTGGCAAGAAGTGCTGTAA

Protein

111 aa

>Os05t0358000-01 Conserved hypothetical protein.
VCDFLGPKLTEPTTAPGARDDSTRKASCSPLTSRLLVIDAAQGTMPTGFVRDEAKGGKSG
GVAPLRRPAAHVPCSFTARSASSKNRGGGVLATRSLRKGTDTGERWQEVL*

5'UTR

chr05:16995503..16995623 (- strand) : 121 bp

CDS

chr05:16995170..16995502 (- strand) : 333 bp

3'UTR

chr05:16992294..16995169 (- strand) : 2876 bp

FASTA

>Os05t0358000-01 class=Sequence position=chr05:16992294..16995623 (- strand)
AGCAGATCAG CAATATCAGA GAAGCCAGCA AAGACGTGCG TCGCCGACGG AATCTGTTGT GTGTGTGTCC ACCCAATTTG
CTGCTCGTGT GTGTTCTCCC GTGAGTTTGT TGCTTACGTG AGTTTGTGAT TTTCTTGGGC CAAAGCTAAC AGAGCCCACG
ACAGCGCCTG GGGCGAGGGA CGACAGCACG CGGAAGGCCT CCTGTAGCCC GTTGACCTCG CGCCTCCTGG TCATCGACGC
CGCCCAAGGC ACCATGCCCA CTGGATTTGT GCGTGACGAG GCCAAGGGAG GCAAATCTGG TGGCGTCGCG CCCCTCCGCC
GCCCGGCGGC ACATGTCCCG TGCTCCTTCA CCGCTAGGAG TGCTTCGAGC AAGAATAGGG GTGGAGGAGT GCTCGCGACA
AGAAGTCTAC GAAAAGGCAC CGACACCGGC GAGAGGTGGC AAGAAGTGCT GTAACGCATG TCTTTCAGGC TCTCATCACT
CACCTCTCGT CTCGCTAGCA ATGTCACACC AAATCCTCAA CACCTCAGCA CACATTCACC ACCGCGCCCT GCATCGGCGA
CTTGCCAGTC ACGGCCAAGC CTTCCAGGAT GTTAGCAGGG AAAATCACCA TTGGCCTCTT CGGCGACGAG GTCCCCGCCG
GTGCGTCCCG GCTCCTGTCG CTTGGTGTCG GCTAGTTAAG ATAGTGTGGG GCTACATGCA AGCAGGACGG TGTGGTGTCA
CACCCGGCCA TCCCGGCGCT GACCGACCGG CTAGCGGCGA AGATGGACGC CGCACGCGCG CGCAATGCGA TGGGGACAGG
AGTGGCGTCC ACCCAACTCC CACGGCATAT GGTGACGGCC GGCGAGGCAG CGGCGGCTGA ACAACTGAGC TTCTAGCTTC
CGTCGAGGAA GAAGCGACCG AACGGGAGAG GGAGAGAGAG AGGAGGAAGA GAGAAGCGAG GAAAAAGAAA AAAAAACAAA
TAAGTGCCAC GTAGGACATG TGGGGTTATT GTTTTTTCTT TTCACTGACA TGCGGGTCCC CTAAGTGCCA CATAGGATGA
AACCGCTATC AAACAGCCGA GGGACTCAAT CTGCTctggt tttcaaagat ggaggagacg ttatacccgg tattgcgatt
gagggaggtt atttaatcag gggcaagagt tgagggaggc aatttatact tattccttac aAGGCAGGGT CCGACATTTC
CAGCCCAAAA GAATCGGACC CATTTATTCG GCCCAATCTG GCCCATGCTC GGGGCCTAGT TTTTCCAGGT AAAGTTGACC
AAAAGTCTTC ACCTAGTCGT CGTCTTCCCT CGGCCGGCCT GACCATGAAA ATAAACGCTA CCCAACGACT CCGCAGTCAC
CTCACCACAC GTCGATGGAC ACGGCGCACC AGTGAACCCC CTCGGCCCCA CCAACCACCA CCACCATCAA CATCCTACCT
TACCTCTCTC TGGCAACCGG GTCCCACCTA AGGTCCACGC TACACCCGGT CCACCAACAC CCGTGGGCCC CACCGCTCTC
TCGTCGTCGC ACCGACCCCA ACCGAAGCGG TAACAAAGCC AACGTCCCAC CACCACCACA CGCGCGCGCT CGCACAGACA
CACACACAGC ACAGCGGAGA AAGAGAGAGA GAGAGAGAGA AAGGAAAAAT CGGCACCACC GCGAAAGGGG GAAAAGGGGG
GAAGGAAGCG AGGCGAGGCT AGGGTTTCGA TTCGATCCCG CCGCTGCCAT GGACGCCGGT GATGCGTGGG GCCGCTCCTC
CTCCTCATCC TCCTCCGCCG CCGCCGCCGC CAGGCGCCTG CAGGCGCGCT ACGGTAAGCT CACACGACGA CGGGTCGGCT
TTCTCTCGAT CCATCGGTCG ATCTCCCCAG CTGTTGGATT GCCATGGGCT GCGATTTGAT GCGTGGGTGG TGGTGGTGGA
TGTGTGTGGG TGTTGGCTCA GATCTGTACA TGGGGTTCGA CGACGCGGAC GCGGCGGGCG TGGAGGAGGT GGAGGCGCGC
GGCGGCGGGG AGGCGTACAA CTGCCCCTTC TGCGGCGAGG ACTTCGACTT CGTCGCCTTC TGCTGCCACG TCGACGACGA
GCACGCCGTC GAGGCCAAGA GCGGGGTATA TGCCACATCC TCCCATCTGA CACCGATTGT AACCGTCAGT ATCAGATTGT
TGTGTTTGTG ATTGGTTGGA TACTTGGACC GGGCCTTGGT TTCGGAAATG TGCAATTCGT AGGCACGCGT GCAAATTTTT
TTTTTAGAAC AGGATGCCTC CGCAGGTATC AACAGATTTC AACTGTGACG AACCAAGACC AGCGAAAGCT TGCAGGTTTT
AGGAGTTGGA ATTTTGGACT TTTTGGTTGG AGTTATAAGA TTGGTTGTTT TGGGGTTTGG GTAGGTGTCT TCGTTTGCTT
GATTGGAGAA AAATAATTCG TAGTGGCTAT CCATGTCGGG GAGAATGATT GATTTTAATT TTGGGGGGTT TAGTTGGGGA
CTTGAGTTTT TTCTGTCTTT TGGGGGGAGT TTGGGACTGG CGGAAAACAT TTCTTGTGTT GTTCATGCTA GTCATTAGCC
TATTACACTC TACTGTAGTT TTTATTTATT TTCTTTCTTG TTCTTAGTAT CTGATGAAAT ATGTTCTCTC AGCTTTCTTT
ATTTTTTGTA AATCTGTGGT CATTTTGCAG CTATTAAGAT CCCAGCTCTA TTCTCTCCAG ATTATAAAGC ACATCAGCAC
TTGTTTCTCT TGAAAGTGAA ACATCCATAC CAAACTGACA ATATTACATA TTTTCATTTC AATCTAACAA TATTACATAT
TTTCATTCAA TCTAACAATA TGATGATTGT TCTTGGCTTG GTGGTTAGGA TTATTATTTG TCTATGGAAG AAAAGAGTGG
TACTAACTAG TGATCACTTT ATGTTTTGTG ATTGGGACTT GTTCATGATT AATAGTGGGA TTCAGTACAA CTTATTACAA
TATCCTTTAT GAACTAGTTC ACCAGTTCCC TTGCTTCGAT CACAAAAATG GGCATAACTT TTCTTTGTTT TGTCTTAGGT
GGTGAAGCTC ATTGAAATTG CAGGAATTTT CATGTTTTAT TGCTTTCGTA GGATCGTTTA CATTATATTT GGATTTGTGA
GATACACCCT TTGATTAATA TTTGAAATTA TGATGGTGCT TGGATACGAG GGAAGGAAGT TTAGATGGTT ACTGGTATTG
TTTTATCTGG TGCTGGTTTA GGAAATTCTC TTTTATCTAT TTCTATTTTC TAAGATGTTT TTCTCAGATA TTGGTTGTTA
GTTCTGACCA TCTTTTGTAA ATAAAAATAA CAGCTTTTGT CTGTTGTATC 

Locus: Os05g0358000

Loading...

Locus: Os05g0358000

Loading...