Os05t0358000-02

Locus

Os05g0358000

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-2

Oryzabase Gene Name Synonym(s)

drought-induced 19-2

Transcript Evidence

AK101263 (DDBJ, Best hit)

Protein Evidence

Q5W794 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

J033032J06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0358000-02)

RiceXPro (AK101263)

Others

Oryzabase (18577)

KEGG (Os05t0358000-02)

Transcript

1286 bp

>Os05t0358000-02 Drought induced 19 family protein.
GCGCGCTCGCACAGACACACACACAGCACAGCGGAGAAAGAGAGAGAGAGAGAGAGAAAG
GAAAAATCGGCACCACCGCGAAAGGGGGAAAAGGGGGGAAGGAAGCGAGGCGAGGCTAGG
GTTTCGATTCGATCCCGCCGCTGCCATGGACGCCGGTGATGCGTGGGGCCGCTCCTCCTC
CTCATCCTCCTCCGCCGCCGCCGCCGCCAGGCGCCTGCAGGCGCGCTACGATCTGTACAT
GGGGTTCGACGACGCGGACGCGGCGGGCGTGGAGGAGGTGGAGGCGCGCGGCGGCGGGGA
GGCGTACAACTGCCCCTTCTGCGGCGAGGACTTCGACTTCGTCGCCTTCTGCTGCCACGT
CGACGACGAGCACGCCGTCGAGGCCAAGAGCGGGGTATGTCCCATCTGTGCTACAAGGGT
TGGAGTGGACTTGATAGGTCACTTGACAATGCAGCATGGAAGTTACTTTAAGATGCAACG
CAGGCGAAGAGTCCGAAAAATATCTTCAGGGTCCCATTCTTTGTTGTCTTTGTTGAGAAA
GGACTTAAGAGATGGCAGTCTGCAGTCCTTTCTTGGTGGATCATCCTATGTATCTAATCC
TCCTGCTGCTGCACCAGATCCATTTTTGTCATCTTTAATTTGTAGTTTGCCTGTGGCTGA
ACCATCCAAAGATTTACATTCCGACTCATCTGACAATAACTTTTTGCTAAATAAATTCCC
AGATGACAAGACTGCAGAGAGAGCTGAACCATCTCTGTCGGAGAAGGATCAGAAGGAGAG
GGCTCAAAGGAGTAAATTTGTCCGTGGGCTTGTGCTCTCGACGATATTTGAGGATGATAA
CTTGTAAGGGAGGTTATCAACCTTAATATAGCGACGGCATGGCATGGTCAAGGAACAGAA
AATACAGGAGAACAATCTATGCAATGCAGCAACCTTGTTCATGCCGTCGCTAATGCTGCT
TCCAGCCTTCAAGGCCAACTGGGGGCCACCCATCATGTTTATGTATGCACGTACGTATAA
TGTATGTCTGCCTTCCTGCATTTGCCGAGAGGGCAACAGGAACCAGCTGAGTAGAGGAGA
AAGGTGTTTGTGTCCCAACCTTCCACGTCGAATAAATGAGGACATTGTGTTCCTTGAGTG
GCTTTGTGCATATATGAAGAGAGGAGAGCTACTCGCAATGTATTAGGTTCTCTCTATTTT
ATTTGATCAATGTAATGTAATAATAGGAAGTGTTGTACAACTGTATTGTAATCCCAATGG
TATGTGATACTGCTTTGTTTTGTATT

CDS

702 bp

>Os05t0358000-02 Drought induced 19 family protein.
ATGGACGCCGGTGATGCGTGGGGCCGCTCCTCCTCCTCATCCTCCTCCGCCGCCGCCGCC
GCCAGGCGCCTGCAGGCGCGCTACGATCTGTACATGGGGTTCGACGACGCGGACGCGGCG
GGCGTGGAGGAGGTGGAGGCGCGCGGCGGCGGGGAGGCGTACAACTGCCCCTTCTGCGGC
GAGGACTTCGACTTCGTCGCCTTCTGCTGCCACGTCGACGACGAGCACGCCGTCGAGGCC
AAGAGCGGGGTATGTCCCATCTGTGCTACAAGGGTTGGAGTGGACTTGATAGGTCACTTG
ACAATGCAGCATGGAAGTTACTTTAAGATGCAACGCAGGCGAAGAGTCCGAAAAATATCT
TCAGGGTCCCATTCTTTGTTGTCTTTGTTGAGAAAGGACTTAAGAGATGGCAGTCTGCAG
TCCTTTCTTGGTGGATCATCCTATGTATCTAATCCTCCTGCTGCTGCACCAGATCCATTT
TTGTCATCTTTAATTTGTAGTTTGCCTGTGGCTGAACCATCCAAAGATTTACATTCCGAC
TCATCTGACAATAACTTTTTGCTAAATAAATTCCCAGATGACAAGACTGCAGAGAGAGCT
GAACCATCTCTGTCGGAGAAGGATCAGAAGGAGAGGGCTCAAAGGAGTAAATTTGTCCGT
GGGCTTGTGCTCTCGACGATATTTGAGGATGATAACTTGTAA

Protein

234 aa

>Os05t0358000-02 Drought induced 19 family protein.
MDAGDAWGRSSSSSSSAAAAARRLQARYDLYMGFDDADAAGVEEVEARGGGEAYNCPFCG
EDFDFVAFCCHVDDEHAVEAKSGVCPICATRVGVDLIGHLTMQHGSYFKMQRRRRVRKIS
SGSHSLLSLLRKDLRDGSLQSFLGGSSYVSNPPAAAPDPFLSSLICSLPVAEPSKDLHSD
SSDNNFLLNKFPDDKTAERAEPSLSEKDQKERAQRSKFVRGLVLSTIFEDDNL*

5'UTR

chr05:16993896..16994040 (- strand) : 145 bp

CDS

chr05:16993811..16993895 (- strand) : 85 bp

chr05:16993519..16993682 (- strand) : 164 bp

chr05:16990476..16990555 (- strand) : 80 bp

chr05:16990071..16990337 (- strand) : 267 bp

chr05:16989403..16989508 (- strand) : 106 bp

3'UTR

chr05:16988964..16989402 (- strand) : 439 bp

FASTA

>Os05t0358000-02 class=Sequence position=chr05:16988964..16994040 (- strand)
GCGCGCTCGC ACAGACACAC ACACAGCACA GCGGAGAAAG AGAGAGAGAG AGAGAGAAAG GAAAAATCGG CACCACCGCG
AAAGGGGGAA AAGGGGGGAA GGAAGCGAGG CGAGGCTAGG GTTTCGATTC GATCCCGCCG CTGCCATGGA CGCCGGTGAT
GCGTGGGGCC GCTCCTCCTC CTCATCCTCC TCCGCCGCCG CCGCCGCCAG GCGCCTGCAG GCGCGCTACG GTAAGCTCAC
ACGACGACGG GTCGGCTTTC TCTCGATCCA TCGGTCGATC TCCCCAGCTG TTGGATTGCC ATGGGCTGCG ATTTGATGCG
TGGGTGGTGG TGGTGGATGT GTGTGGGTGT TGGCTCAGAT CTGTACATGG GGTTCGACGA CGCGGACGCG GCGGGCGTGG
AGGAGGTGGA GGCGCGCGGC GGCGGGGAGG CGTACAACTG CCCCTTCTGC GGCGAGGACT TCGACTTCGT CGCCTTCTGC
TGCCACGTCG ACGACGAGCA CGCCGTCGAG GCCAAGAGCG GGGTATATGC CACATCCTCC CATCTGACAC CGATTGTAAC
CGTCAGTATC AGATTGTTGT GTTTGTGATT GGTTGGATAC TTGGACCGGG CCTTGGTTTC GGAAATGTGC AATTCGTAGG
CACGCGTGCA AATTTTTTTT TTAGAACAGG ATGCCTCCGC AGGTATCAAC AGATTTCAAC TGTGACGAAC CAAGACCAGC
GAAAGCTTGC AGGTTTTAGG AGTTGGAATT TTGGACTTTT TGGTTGGAGT TATAAGATTG GTTGTTTTGG GGTTTGGGTA
GGTGTCTTCG TTTGCTTGAT TGGAGAAAAA TAATTCGTAG TGGCTATCCA TGTCGGGGAG AATGATTGAT TTTAATTTTG
GGGGGTTTAG TTGGGGACTT GAGTTTTTTC TGTCTTTTGG GGGGAGTTTG GGACTGGCGG AAAACATTTC TTGTGTTGTT
CATGCTAGTC ATTAGCCTAT TACACTCTAC TGTAGTTTTT ATTTATTTTC TTTCTTGTTC TTAGTATCTG ATGAAATATG
TTCTCTCAGC TTTCTTTATT TTTTGTAAAT CTGTGGTCAT TTTGCAGCTA TTAAGATCCC AGCTCTATTC TCTCCAGATT
ATAAAGCACA TCAGCACTTG TTTCTCTTGA AAGTGAAACA TCCATACCAA ACTGACAATA TTACATATTT TCATTTCAAT
CTAACAATAT TACATATTTT CATTCAATCT AACAATATGA TGATTGTTCT TGGCTTGGTG GTTAGGATTA TTATTTGTCT
ATGGAAGAAA AGAGTGGTAC TAACTAGTGA TCACTTTATG TTTTGTGATT GGGACTTGTT CATGATTAAT AGTGGGATTC
AGTACAACTT ATTACAATAT CCTTTATGAA CTAGTTCACC AGTTCCCTTG CTTCGATCAC AAAAATGGGC ATAACTTTTC
TTTGTTTTGT CTTAGGTGGT GAAGCTCATT GAAATTGCAG GAATTTTCAT GTTTTATTGC TTTCGTAGGA TCGTTTACAT
TATATTTGGA TTTGTGAGAT ACACCCTTTG ATTAATATTT GAAATTATGA TGGTGCTTGG ATACGAGGGA AGGAAGTTTA
GATGGTTACT GGTATTGTTT TATCTGGTGC TGGTTTAGGA AATTCTCTTT TATCTATTTC TATTTTCTAA GATGTTTTTC
TCAGATATTG GTTGTTAGTT CTGACCATCT TTTGTAAATA AAAATAACAG CTTTTGTCTG TTGTATCAGA ATACCTGTAT
AATTAGTGTT GATATTGGCA TCTTTGTGGT ACTATGTAAA TATTGGGTAG CTGCCAAGCT GGATAGTTTC TGGGTATGTA
TTAGTAACGT TGGATTTGTG ACATTTTATT TGGTGGTGAT GTACTTTGGT CTATCTTTTT GTGATGCTAT TATTTGTGCC
TCATCTATAT AACCATGCCC GAGAGCTTTC TTGATATATT CAAGTCAGTT TATGAATTGA AATTTTCAAT GTTAGCCTTT
TCATGAAAGA TGTGACATGG GTGTGATTCA TAACTGTTTA ATGTGTATAT TTTAGTTGTC TTGAATTGAA TTGAATTTCG
ATTCTTCCAT CTTTGTTTAG GTATATTGTT AGACTCTTTG AAACATAATA AAACTAAATT ATTCACTGTG TGCTTCTGAA
TGATTAAACT TTTTGTATAA TCATATGCAA TTGCCCTTGA ATAGGCATTA TTTGTCTTTA TGTTAGATCC AATCAGGGAT
CGCTATATGT TACTAATAGA AATTATTTAT CTCAATATTA GGAGGCAACT AACAAATCAT TTTCAAATTC AAAGCAGAAA
TGCCTTCAAT TGAGTTGGCG GTTCTAGCCA CAATGGGCAA ACATGAGACA TCTTACAACA TATTGCACGT GAATAATAGT
GAATAGGATC ATGCGGTACT GTAGCTCATA CTTCAACATA AATTGGTTTA TTATATAGAG AGAGTGTTAT GTTGATCTTA
TTGTTAACCT TGAGATTAAA TTGTTAGATT CTACATAAGG AAAGGCAGCA TGTAATTTGG ATCAACTTAG AATGTAATGT
CTTTCTCTCC TAATGTTTTC TATTATCCCA GTCTACAGTA TCCTCTCTAT CTGAAAATAC CCCCCTTCAG CCATATTGTC
CTGGCCCTCT TATGTGCATT GTTAAGCCCT TCTATTTATA AGAAAGTGTT TGATTTCATA TCTTTTTCTT TATTTAGTTG
GCATAGCTTA AGTATTGTTG TACTATGCTA GGTCTCAATA TTCACATATA GCTAGTGTTT GTGGCAAAAC TAACCTTGAC
CAACTATATC ATGACAGAAA TCTTACATTA TTGTGGTGAC ATGAATCCAT ACCTTTCCTT AGGCCTGTCT GTACGTGAGA
GCATTTTCTA CTTTGTGTTA TACAAGGATT GTCTAGTTCC TTTGGTGTAC TTAAATACTT GCCTATTTGT TACTGGAGAA
AAGATGATGT GCTCATGGCA ATCTCCCAAG TCCCAATCAT TGGTGCTGCA AATCCTTCTT CTCCATTTTA TTCCACTCTT
TTCTTTATCC AGAAGACTGA TTGGAAAAAA ACAACCCATG CTCAAGCAAG CCAAGCATGT CCATAAAGCA TTTAGCTTAG
GGTTTCCTAT TGATCAAATT CGTTAAGACC CTATTGTATT TGAAATTTCC TGTGGAGAAA ACAGTCTCAA GTTGTGAATT
CCTTCTGGAA TATTTTTAAT AGGGTGTGTT ATGCTGGGTT ACCTGGAATA TGTACTGAAT GCTGGAAAGA GGTATCCAAA
AGAATGAAAG AGAATTAGTG CCTGCTTACG TTAGCAGTCA TGATTACTGC TTAATGATAT TTCCTACTTA GTTGCTTCTT
TTATCATCAC ATAAGACTAG TTAGAAACTG TCTTATCTAT TTGAACTTTG CCTGCATAAG AGATATTATA GCATTAAAAT
GATTTAATGG GAGCACTTAT GGAACTTGAT TAATTGCCCT TTCAGGTATG TCCCATCTGT GCTACAAGGG TTGGAGTGGA
CTTGATAGGT CACTTGACAA TGCAGCATGG AAGTTACTTT AAGATATCCT TTTTTCTTCT CTATAATGCT GGCAATGAAC
ATATGCAATT TTACATTTTT ACATCATATT CAGTTGAAGA TACATGGCAT TATTGGTACT TGGGAAAACA ACTGCACATG
GCTTTCCTTA ATGAATAATA CATGCAACGC AGGCGAAGAG TCCGAAAAAT ATCTTCAGGG TCCCATTCTT TGTTGTCTTT
GTTGAGAAAG GACTTAAGAG ATGGCAGTCT GCAGTCCTTT CTTGGTGGAT CATCCTATGT ATCTAATCCT CCTGCTGCTG
CACCAGATCC ATTTTTGTCA TCTTTAATTT GTAGTTTGCC TGTGGCTGAA CCATCCAAAG ATTTACATTC CGACTCATCT
GACAATAACT TTTTGCTAAA TAAATTCCCA GATGACAAGA CTGCAGAGAG GTATGTCACC TCAAGCTTTG CTCTTTCTGC
CGCCTCACTC CGCTCCCTCT TTGCCACAAT ACCACTGTAT CTGGTCAGTG GATGATAGTT TTGATGTTTT ATTCAGTTTT
TATTTTATAT TGTTGCCCTT GTGCATACTT AATTATGCTG CTGTCGTGTT ACGTTACTGG GCTAGTACTA TTGTTTTTGT
TGCTCAAGAA ACCATGCTTC TAGAAAATTG TCAGAAACTA ATGAATATAA AGCTAACTAG GCGCTTTAAG ATATTTAATA
TAACATCCTG CACAATCTGC ACGGCTGAGT GAGTTCCCAT TGTGTCCATG CTTTTTATTG AGATCTCTGA ACCATCAAAA
GAACAAATTC CATTGCTGAC AATTGGTTGA TTGCATTGTC ACTTAGCACC TCACATGGTT TAAGGAGAAT GCAAATTCTT
AGATGTGCCA TGAGAATTTT AGTTGAACCT TCAGAAATGA TTTTTTTTTG CTGCAGCTTA ATGTCCTATT AGATAGCCAT
AGATGATTAT TCACTGTCAA ATGTTGATTA AATATCTGTG ATAATTTTTC AGAGCTGAAC CATCTCTGTC GGAGAAGGAT
CAGAAGGAGA GGGCTCAAAG GAGTAAATTT GTCCGTGGGC TTGTGCTCTC GACGATATTT GAGGATGATA ACTTGTAAGG
GAGGTTATCA ACCTTAATAT AGCGACGGCA TGGCATGGTC AAGGAACAGA AAATACAGGA GAACAATCTA TGCAATGCAG
CAACCTTGTT CATGCCGTCG CTAATGCTGC TTCCAGCCTT CAAGGCCAAC TGGGGGCCAC CCATCATGTT TATGTATGCA
CGTACGTATA ATGTATGTCT GCCTTCCTGC ATTTGCCGAG AGGGCAACAG GAACCAGCTG AGTAGAGGAG AAAGGTGTTT
GTGTCCCAAC CTTCCACGTC GAATAAATGA GGACATTGTG TTCCTTGAGT GGCTTTGTGC ATATATGAAG AGAGGAGAGC
TACTCGCAAT GTATTAGGTT CTCTCTATTT TATTTGATCA ATGTAATGTA ATAATAGGAA GTGTTGTACA ACTGTATTGT
AATCCCAATG GTATGTGATA CTGCTTTGTT TTGTATT

Locus: Os05g0358000

Loading...

Locus: Os05g0358000

Loading...