Os05t0358000-03

Locus

Os05g0358000

Description

Drought induced 19 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsDi19-2

Oryzabase Gene Name Synonym(s)

drought-induced 19-2

Transcript Evidence

AK061141 (DDBJ, Best hit)

Protein Evidence

Q5W794 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Drought induced 19/ RING finger protein 114 (IPR008598)

Full-length cDNA

006-208-C03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0358000-03)

RiceXPro (AK061141)

Others

Oryzabase (18577)

KEGG (Os05t0358000-03)

Transcript

1248 bp

>Os05t0358000-03 Drought induced 19 family protein.
GGCACCACCGCGAAAGGGGGAAAAGGGGGGAAGGAAGCGAGGCGAGGCTAGGGTTTCGAT
TCGATCCCGCCGCTGCCATGGACGCCGGTGATGCGTGGGGCCGCTCCTCCTCCTCATCCT
CCTCCGCCGCCGCCGCCGCCAGGCGCCTGCAGGCGCGCTACGATCTGTACATGGGGTTCG
ACGACGCGGACGCGGCGGGCGTGGAGGAGGTGGAGGCGCGCGGCGGCGGGGAGGCGTACA
ACTGCCCCTTCTGCGGCGAGGACTTCGACTTCGTCGCCTTCTGCTGCCACGTCGACGACG
AGCACGCCGTCGAGGCCAAGAGCGGGGTATGTCCCATCTGTGCTACAAGGGTTGGAGTGG
ACTTGATAGGTCACTTGACAATGCAGCATGGAAGTTACTTTAAGATGCAACGCAGGCGAA
GAGTCCGAAAAATATCTTCAGGGTCCCATTCTTTGTTGTCTTTGTTGAGAAAGGACTTAA
GAGATGGCAGTCTGCAGTCCTTTCTTGGTGGATCATCCTATGTATCTAATCCTCCTGCTG
CTGCACCAGATCCATTTTTGTCATCTTTAATTTGTAGTTTGCCTGTGGCTGAACCATCCA
AAGATTTACATTCCGACTCATCTGACAATAACTTTTTGCTAAATAAATTCCCAGATGACA
AGACTGCAGAGAGAGCTGAACCATCTCTGTCGGAGAAGGATCAGAAGGAGAGGGCTCAAA
GGAGTAAATTTGTCCGTGGGCTTGTGCTCTCGACGATATTTGAGGATGATAACTTGTAAG
GGAGGTTATCAACCTTAATATAGCGACGGCATGGCATGGTCAAGGAACAGAAAATACAGG
AGAACAATCTATGCAATGCAGCAACCTTGTTCATGCCGTCGCTAATGCTGCTTCCAGCCT
TCAAGGCCAACTGGGGGCCACCCATCATGTTTATGTATGCACGTACGTATAATGTATGTC
TGCCTTCCTGCATTTGCCGAGAGGGCAACAGGAACCAGCTGAGTAGAGGAGAAAGGTGTT
TGTGTCCCAACCTTCCACGTCGAATAAATGAGGACATTGTGTTCCTTGAGTGGCTTTGTG
CATATATGAAGAGAGGAGAGCTACTCGCAATGTATTAGGTTCTCTCTATTTTATTTGATC
AATGTAATGTAATAATAGGAAGTGTTGTACAACTGTATTGTAATCCCAATGGTATGTGAT
ACTGCTTTGTTTTGTATTTATTGAATAGCCAGTGTGGCCAATTGATCT

CDS

702 bp

>Os05t0358000-03 Drought induced 19 family protein.
ATGGACGCCGGTGATGCGTGGGGCCGCTCCTCCTCCTCATCCTCCTCCGCCGCCGCCGCC
GCCAGGCGCCTGCAGGCGCGCTACGATCTGTACATGGGGTTCGACGACGCGGACGCGGCG
GGCGTGGAGGAGGTGGAGGCGCGCGGCGGCGGGGAGGCGTACAACTGCCCCTTCTGCGGC
GAGGACTTCGACTTCGTCGCCTTCTGCTGCCACGTCGACGACGAGCACGCCGTCGAGGCC
AAGAGCGGGGTATGTCCCATCTGTGCTACAAGGGTTGGAGTGGACTTGATAGGTCACTTG
ACAATGCAGCATGGAAGTTACTTTAAGATGCAACGCAGGCGAAGAGTCCGAAAAATATCT
TCAGGGTCCCATTCTTTGTTGTCTTTGTTGAGAAAGGACTTAAGAGATGGCAGTCTGCAG
TCCTTTCTTGGTGGATCATCCTATGTATCTAATCCTCCTGCTGCTGCACCAGATCCATTT
TTGTCATCTTTAATTTGTAGTTTGCCTGTGGCTGAACCATCCAAAGATTTACATTCCGAC
TCATCTGACAATAACTTTTTGCTAAATAAATTCCCAGATGACAAGACTGCAGAGAGAGCT
GAACCATCTCTGTCGGAGAAGGATCAGAAGGAGAGGGCTCAAAGGAGTAAATTTGTCCGT
GGGCTTGTGCTCTCGACGATATTTGAGGATGATAACTTGTAA

Protein

234 aa

>Os05t0358000-03 Drought induced 19 family protein.
MDAGDAWGRSSSSSSSAAAAARRLQARYDLYMGFDDADAAGVEEVEARGGGEAYNCPFCG
EDFDFVAFCCHVDDEHAVEAKSGVCPICATRVGVDLIGHLTMQHGSYFKMQRRRRVRKIS
SGSHSLLSLLRKDLRDGSLQSFLGGSSYVSNPPAAAPDPFLSSLICSLPVAEPSKDLHSD
SSDNNFLLNKFPDDKTAERAEPSLSEKDQKERAQRSKFVRGLVLSTIFEDDNL*

5'UTR

chr05:16993896..16993972 (- strand) : 77 bp

CDS

chr05:16993811..16993895 (- strand) : 85 bp

chr05:16993519..16993682 (- strand) : 164 bp

chr05:16990476..16990555 (- strand) : 80 bp

chr05:16990071..16990337 (- strand) : 267 bp

chr05:16989403..16989508 (- strand) : 106 bp

3'UTR

chr05:16988934..16989402 (- strand) : 469 bp

FASTA

>Os05t0358000-03 class=Sequence position=chr05:16988934..16993972 (- strand)
GGCACCACCG CGAAAGGGGG AAAAGGGGGG AAGGAAGCGA GGCGAGGCTA GGGTTTCGAT TCGATCCCGC CGCTGCCATG
GACGCCGGTG ATGCGTGGGG CCGCTCCTCC TCCTCATCCT CCTCCGCCGC CGCCGCCGCC AGGCGCCTGC AGGCGCGCTA
CGGTAAGCTC ACACGACGAC GGGTCGGCTT TCTCTCGATC CATCGGTCGA TCTCCCCAGC TGTTGGATTG CCATGGGCTG
CGATTTGATG CGTGGGTGGT GGTGGTGGAT GTGTGTGGGT GTTGGCTCAG ATCTGTACAT GGGGTTCGAC GACGCGGACG
CGGCGGGCGT GGAGGAGGTG GAGGCGCGCG GCGGCGGGGA GGCGTACAAC TGCCCCTTCT GCGGCGAGGA CTTCGACTTC
GTCGCCTTCT GCTGCCACGT CGACGACGAG CACGCCGTCG AGGCCAAGAG CGGGGTATAT GCCACATCCT CCCATCTGAC
ACCGATTGTA ACCGTCAGTA TCAGATTGTT GTGTTTGTGA TTGGTTGGAT ACTTGGACCG GGCCTTGGTT TCGGAAATGT
GCAATTCGTA GGCACGCGTG CAAATTTTTT TTTTAGAACA GGATGCCTCC GCAGGTATCA ACAGATTTCA ACTGTGACGA
ACCAAGACCA GCGAAAGCTT GCAGGTTTTA GGAGTTGGAA TTTTGGACTT TTTGGTTGGA GTTATAAGAT TGGTTGTTTT
GGGGTTTGGG TAGGTGTCTT CGTTTGCTTG ATTGGAGAAA AATAATTCGT AGTGGCTATC CATGTCGGGG AGAATGATTG
ATTTTAATTT TGGGGGGTTT AGTTGGGGAC TTGAGTTTTT TCTGTCTTTT GGGGGGAGTT TGGGACTGGC GGAAAACATT
TCTTGTGTTG TTCATGCTAG TCATTAGCCT ATTACACTCT ACTGTAGTTT TTATTTATTT TCTTTCTTGT TCTTAGTATC
TGATGAAATA TGTTCTCTCA GCTTTCTTTA TTTTTTGTAA ATCTGTGGTC ATTTTGCAGC TATTAAGATC CCAGCTCTAT
TCTCTCCAGA TTATAAAGCA CATCAGCACT TGTTTCTCTT GAAAGTGAAA CATCCATACC AAACTGACAA TATTACATAT
TTTCATTTCA ATCTAACAAT ATTACATATT TTCATTCAAT CTAACAATAT GATGATTGTT CTTGGCTTGG TGGTTAGGAT
TATTATTTGT CTATGGAAGA AAAGAGTGGT ACTAACTAGT GATCACTTTA TGTTTTGTGA TTGGGACTTG TTCATGATTA
ATAGTGGGAT TCAGTACAAC TTATTACAAT ATCCTTTATG AACTAGTTCA CCAGTTCCCT TGCTTCGATC ACAAAAATGG
GCATAACTTT TCTTTGTTTT GTCTTAGGTG GTGAAGCTCA TTGAAATTGC AGGAATTTTC ATGTTTTATT GCTTTCGTAG
GATCGTTTAC ATTATATTTG GATTTGTGAG ATACACCCTT TGATTAATAT TTGAAATTAT GATGGTGCTT GGATACGAGG
GAAGGAAGTT TAGATGGTTA CTGGTATTGT TTTATCTGGT GCTGGTTTAG GAAATTCTCT TTTATCTATT TCTATTTTCT
AAGATGTTTT TCTCAGATAT TGGTTGTTAG TTCTGACCAT CTTTTGTAAA TAAAAATAAC AGCTTTTGTC TGTTGTATCA
GAATACCTGT ATAATTAGTG TTGATATTGG CATCTTTGTG GTACTATGTA AATATTGGGT AGCTGCCAAG CTGGATAGTT
TCTGGGTATG TATTAGTAAC GTTGGATTTG TGACATTTTA TTTGGTGGTG ATGTACTTTG GTCTATCTTT TTGTGATGCT
ATTATTTGTG CCTCATCTAT ATAACCATGC CCGAGAGCTT TCTTGATATA TTCAAGTCAG TTTATGAATT GAAATTTTCA
ATGTTAGCCT TTTCATGAAA GATGTGACAT GGGTGTGATT CATAACTGTT TAATGTGTAT ATTTTAGTTG TCTTGAATTG
AATTGAATTT CGATTCTTCC ATCTTTGTTT AGGTATATTG TTAGACTCTT TGAAACATAA TAAAACTAAA TTATTCACTG
TGTGCTTCTG AATGATTAAA CTTTTTGTAT AATCATATGC AATTGCCCTT GAATAGGCAT TATTTGTCTT TATGTTAGAT
CCAATCAGGG ATCGCTATAT GTTACTAATA GAAATTATTT ATCTCAATAT TAGGAGGCAA CTAACAAATC ATTTTCAAAT
TCAAAGCAGA AATGCCTTCA ATTGAGTTGG CGGTTCTAGC CACAATGGGC AAACATGAGA CATCTTACAA CATATTGCAC
GTGAATAATA GTGAATAGGA TCATGCGGTA CTGTAGCTCA TACTTCAACA TAAATTGGTT TATTATATAG AGAGAGTGTT
ATGTTGATCT TATTGTTAAC CTTGAGATTA AATTGTTAGA TTCTACATAA GGAAAGGCAG CATGTAATTT GGATCAACTT
AGAATGTAAT GTCTTTCTCT CCTAATGTTT TCTATTATCC CAGTCTACAG TATCCTCTCT ATCTGAAAAT ACCCCCCTTC
AGCCATATTG TCCTGGCCCT CTTATGTGCA TTGTTAAGCC CTTCTATTTA TAAGAAAGTG TTTGATTTCA TATCTTTTTC
TTTATTTAGT TGGCATAGCT TAAGTATTGT TGTACTATGC TAGGTCTCAA TATTCACATA TAGCTAGTGT TTGTGGCAAA
ACTAACCTTG ACCAACTATA TCATGACAGA AATCTTACAT TATTGTGGTG ACATGAATCC ATACCTTTCC TTAGGCCTGT
CTGTACGTGA GAGCATTTTC TACTTTGTGT TATACAAGGA TTGTCTAGTT CCTTTGGTGT ACTTAAATAC TTGCCTATTT
GTTACTGGAG AAAAGATGAT GTGCTCATGG CAATCTCCCA AGTCCCAATC ATTGGTGCTG CAAATCCTTC TTCTCCATTT
TATTCCACTC TTTTCTTTAT CCAGAAGACT GATTGGAAAA AAACAACCCA TGCTCAAGCA AGCCAAGCAT GTCCATAAAG
CATTTAGCTT AGGGTTTCCT ATTGATCAAA TTCGTTAAGA CCCTATTGTA TTTGAAATTT CCTGTGGAGA AAACAGTCTC
AAGTTGTGAA TTCCTTCTGG AATATTTTTA ATAGGGTGTG TTATGCTGGG TTACCTGGAA TATGTACTGA ATGCTGGAAA
GAGGTATCCA AAAGAATGAA AGAGAATTAG TGCCTGCTTA CGTTAGCAGT CATGATTACT GCTTAATGAT ATTTCCTACT
TAGTTGCTTC TTTTATCATC ACATAAGACT AGTTAGAAAC TGTCTTATCT ATTTGAACTT TGCCTGCATA AGAGATATTA
TAGCATTAAA ATGATTTAAT GGGAGCACTT ATGGAACTTG ATTAATTGCC CTTTCAGGTA TGTCCCATCT GTGCTACAAG
GGTTGGAGTG GACTTGATAG GTCACTTGAC AATGCAGCAT GGAAGTTACT TTAAGATATC CTTTTTTCTT CTCTATAATG
CTGGCAATGA ACATATGCAA TTTTACATTT TTACATCATA TTCAGTTGAA GATACATGGC ATTATTGGTA CTTGGGAAAA
CAACTGCACA TGGCTTTCCT TAATGAATAA TACATGCAAC GCAGGCGAAG AGTCCGAAAA ATATCTTCAG GGTCCCATTC
TTTGTTGTCT TTGTTGAGAA AGGACTTAAG AGATGGCAGT CTGCAGTCCT TTCTTGGTGG ATCATCCTAT GTATCTAATC
CTCCTGCTGC TGCACCAGAT CCATTTTTGT CATCTTTAAT TTGTAGTTTG CCTGTGGCTG AACCATCCAA AGATTTACAT
TCCGACTCAT CTGACAATAA CTTTTTGCTA AATAAATTCC CAGATGACAA GACTGCAGAG AGGTATGTCA CCTCAAGCTT
TGCTCTTTCT GCCGCCTCAC TCCGCTCCCT CTTTGCCACA ATACCACTGT ATCTGGTCAG TGGATGATAG TTTTGATGTT
TTATTCAGTT TTTATTTTAT ATTGTTGCCC TTGTGCATAC TTAATTATGC TGCTGTCGTG TTACGTTACT GGGCTAGTAC
TATTGTTTTT GTTGCTCAAG AAACCATGCT TCTAGAAAAT TGTCAGAAAC TAATGAATAT AAAGCTAACT AGGCGCTTTA
AGATATTTAA TATAACATCC TGCACAATCT GCACGGCTGA GTGAGTTCCC ATTGTGTCCA TGCTTTTTAT TGAGATCTCT
GAACCATCAA AAGAACAAAT TCCATTGCTG ACAATTGGTT GATTGCATTG TCACTTAGCA CCTCACATGG TTTAAGGAGA
ATGCAAATTC TTAGATGTGC CATGAGAATT TTAGTTGAAC CTTCAGAAAT GATTTTTTTT TGCTGCAGCT TAATGTCCTA
TTAGATAGCC ATAGATGATT ATTCACTGTC AAATGTTGAT TAAATATCTG TGATAATTTT TCAGAGCTGA ACCATCTCTG
TCGGAGAAGG ATCAGAAGGA GAGGGCTCAA AGGAGTAAAT TTGTCCGTGG GCTTGTGCTC TCGACGATAT TTGAGGATGA
TAACTTGTAA GGGAGGTTAT CAACCTTAAT ATAGCGACGG CATGGCATGG TCAAGGAACA GAAAATACAG GAGAACAATC
TATGCAATGC AGCAACCTTG TTCATGCCGT CGCTAATGCT GCTTCCAGCC TTCAAGGCCA ACTGGGGGCC ACCCATCATG
TTTATGTATG CACGTACGTA TAATGTATGT CTGCCTTCCT GCATTTGCCG AGAGGGCAAC AGGAACCAGC TGAGTAGAGG
AGAAAGGTGT TTGTGTCCCA ACCTTCCACG TCGAATAAAT GAGGACATTG TGTTCCTTGA GTGGCTTTGT GCATATATGA
AGAGAGGAGA GCTACTCGCA ATGTATTAGG TTCTCTCTAT TTTATTTGAT CAATGTAATG TAATAATAGG AAGTGTTGTA
CAACTGTATT GTAATCCCAA TGGTATGTGA TACTGCTTTG TTTTGTATTT ATTGAATAGC CAGTGTGGCC AATTGATCT

Locus: Os05g0358000

Loading...

Locus: Os05g0358000

Loading...