Os05t0372100-01

Locus

Os05g0372100

Description

Similar to protein kinase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK185

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 185

Oryzabase Gene Symbol Synonym(s)

OsRLCK185

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 185

Transcript Evidence

AK111898 (DDBJ, Best hit)

Protein Evidence

XP_002871824.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J013064P06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0372100-01)

RiceXPro (AK111898)

Others

Oryzabase (12338)

KEGG (Os05t0372100-01)

Transcript

2363 bp

>Os05t0372100-01 Similar to protein kinase family protein.
ATCTCACTCTTGCCCCTGGGCTGACTTTTGCCCTCCCTTGGGCATCCATCTCCTCTCCCT
CCCTCCCCTCCCCTCCCATCCCTACCCCCAAAATCGCCGACCGACCGCCCCCAAATCCCA
TCCAAGAGCCGTCGCCTCCTCCAAAGATCGGATTTCGAGACCCCCCAGATCGGGGGGAGA
GATCCCCGTGTCGTCTGGTGTGGTGGGTCGGCCTCCGCCCCCCGGCCGCCGCGCTTCTCT
TGATCTTTCTTTCTTTTTTTTGATTTTTTTGCGTTTCCCCTCCGGGAGAGGGGAGGGGAG
GAGGGTTCTTGGATGGGCTGCTTTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAG
AAGGGCGGCGGCGGGCGCAAGGACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGA
TCAGATAAATCAAAATCACAGGGTGGATTGGACTCTAGGAAGGATGCATTCATCCCAAGG
GATGCGAATGGTCAACCTATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCC
ACTAAGAACTTCAGACAAGATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAA
GGACACTTGGAGAATGGGCAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAA
GGAAATAGAGAGTTTCTGGTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTG
GTTAACCTAATTGGATACTGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATG
CCATTGGGATCACTTGAGGATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGAC
TGGAATACACGGATGAAGATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGAC
AAGGCAAATCCTCCTGTTATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGGTGAG
GGATACCATCCAAAACTATCAGACTTTGGCCTGGCAAAACTTGGCCCTGTTGGTGACAAA
ACTCATGTTTCGACACGTGTTATGGGAACTTATGGCTACTGTGCCCCAGAATATGCGATG
ACTGGGCAGCTTACTGTTAAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTG
ATTACTGGCCGCAAAGCAATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCA
TGGGCCCGTCCCCTGTTTAAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTT
GCGGGCCGATTTCCTATGCGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTG
CAGGAGCAAGCTGCCACTAGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTT
GCTTCCCAGACATATGATCCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACC
CCTAGGGCCAGAAACCGTGTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAAT
CACCAACAATCTCCAGATTTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAG
GTTAGCAGGACTAATTCTGGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGAT
GTGACAGGTTCACAGATGGGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGG
AGTACTGATAGGCAGCGTGCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAA
AGAAAGTGGCCAAATGCTCGTGGCAGCTTTGATAGTACAAATGAGTAAACCTCTGAAGCA
GAAGGTTCAGTTAAGTCGTCATTCTAGGGGAAAAAAAAAGATGAATCACTTGCAGAACCC
AACTGGGTCGAATTAGGTACATGGGGCATTTTCGCTCCATCTCGGCTCTGCGGTCTATGT
GAATAGAGCTTCTCTTTTTCTTTTTTCTGTCCTGGAGACACCACCGCTGCTTCAGAGCTC
TCCTCTCGTCCATACGAATAGCATCACCGCGATCTCATCGTCGACGCGCCTATTCCTGGC
GTCCATTCCTCGTGATTGATCATGCAAATGTGCCTTTTATTCATCATGAAGACAGAAACA
CCGTTTGGCTGGAAATGTAGGTAGAAAGCAAAAGAGAAAATTTGCTCTGGAGCTATCCAT
TGGGTATCTCATGTCGATGTTGTTGCATGATGAGTGTCAGCGGCTGCACCATTGTTCCTG
AGTGTTCTAGCTCTATGTGAAGTGAAGTCTGCGTACCGAGGGATGTGATGTTCTTTTTTC
TTTTCTTTTCTTTTCTTTTTGTCTCAATGGTTTGTACCTAGGGGGTACGGCATTTTACCT
GTGTTTCATACACCTGTCATTTG

CDS

1476 bp

>Os05t0372100-01 Similar to protein kinase family protein.
ATGGGCTGCTTTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGC
GGGCGCAAGGACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGATAAATCA
AAATCACAGGGTGGATTGGACTCTAGGAAGGATGCATTCATCCCAAGGGATGCGAATGGT
CAACCTATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTC
AGACAAGATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAG
AATGGGCAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAG
TTTCTGGTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATT
GGATACTGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCA
CTTGAGGATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGG
ATGAAGATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCT
CCTGTTATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGGTGAGGGATACCATCCA
AAACTATCAGACTTTGGCCTGGCAAAACTTGGCCCTGTTGGTGACAAAACTCATGTTTCG
ACACGTGTTATGGGAACTTATGGCTACTGTGCCCCAGAATATGCGATGACTGGGCAGCTT
ACTGTTAAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACTGGCCGC
AAAGCAATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCCCGTCCC
CTGTTTAAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGCCGATTT
CCTATGCGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAGCAAGCT
GCCACTAGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCCCAGACA
TATGATCCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGGGCCAGA
AACCGTGTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAACAATCT
CCAGATTTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAGGTTAGCAGGACT
AATTCTGGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACAGGTTCA
CAGATGGGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACTGATAGG
CAGCGTGCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAGTGGCCA
AATGCTCGTGGCAGCTTTGATAGTACAAATGAGTAA

Protein

492 aa

>Os05t0372100-01 Similar to protein kinase family protein.
MGCFPCFGSGGKGEAKKGGGGRKDGGSADRRVARVGSDKSKSQGGLDSRKDAFIPRDANG
QPIAAHTFTFRELAAATKNFRQDCLLGEGGFGRVYKGHLENGQAVAVKQLDRNGLQGNRE
FLVEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTR
MKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVS
TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPLGEQNLVAWARP
LFKDRRKFPKMADPLLAGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQT
YDPNTPVQHSRSNASTPRARNRVGANFDQRRLHSPNHQQSPDLRKEGTTTSKYEAEVSRT
NSGSGSGRRAGLDSMDVTGSQMGSPAHAGRKRESSRSTDRQRAVAEAKTWGENSRERKWP
NARGSFDSTNE*

5'UTR

chr05:17922839..17923150 (+ strand) : 312 bp

CDS

chr05:17923151..17923262 (+ strand) : 112 bp

chr05:17926331..17926527 (+ strand) : 197 bp

chr05:17926730..17926919 (+ strand) : 190 bp

chr05:17927556..17927947 (+ strand) : 392 bp

chr05:17929069..17929653 (+ strand) : 585 bp

3'UTR

chr05:17929654..17930228 (+ strand) : 575 bp

FASTA

>Os05t0372100-01 class=Sequence position=chr05:17922839..17930228 (+ strand)
ATCTCACTCT TGCCCCTGGG CTGACTTTTG CCCTCCCTTG GGCATCCATC TCCTCTCCCT CCCTCCCCTC CCCTCCCATC
CCTACCCCCA AAATCGCCGA CCGACCGCCC CCAAATCCCA TCCAAGAGCC GTCGCCTCCT CCAAAGATCG GATTTCGAGA
CCCCCCAGAT CGGGGGGAGA GATCCCCGTG TCGTCTGGTG TGGTGGGTCG GCCTCCGCCC CCCGGCCGCC GCGCTTCTCT
TGATCTTTCT TTCTTTTTTT TGATTTTTTT GCGTTTCCCC TCCGGGAGAG GGGAGGGGAG GAGGGTTCTT GGATGGGCTG
CTTTCCGTGC TTCGGGTCGG GCGGCAAGGG GGAGGCGAAG AAGGGCGGCG GCGGGCGCAA GGACGGCGGC TCGGCGGATC
GCCGCGTCGC CCGGGTCGGA TCAGGTGCGG TTCTTGTGGT GGGGGTGTGG GGGGAAAGGG TTGGATCTTG GGGGTGGTTT
TGTTTGTAGG AAATGGTAGC TGATGATTTG CTCCGATGTG GTCAGTTCAT GAGATTTTGG TGTGATTCGG ATCAATGGGC
GATTCGAACT TTGTGCTAAC ACGTATTCGA TTTTAGCGAA TGGGTTGGAG ACAATCTCGA GGTTTCGGCG CGGATGGTGG
TGTGGTGGTA TTTGGGAGAT TTTCCTTTTG TTTGTGTTAG GCTATTTTGA TGGTATGAGT GCTTGATGTT AGTATGCGTT
ACTTATCTAT TTGTAGTTTA TCTGTGATGT TTTGGATCGG TAAGCTAGGT CATCCTTTTT GGTTTATCCT ATAACTGATA
GAAGCCAGCG GCTTTAGTGA TATTTTCGTG GATGGATAGG AGGTTGTGGA TGGATAGGAG GTTGCAGTAT GACTCTTGCA
GTATTGGATT CAGGGGGACA AGGAAATTAA TGTTTCACTT CTTGTTTATA CTGATAAATG ATGTGGAAGT ACTTGCAAGA
CTGCTATAGA TGTATATGAA GAAATGGACG AGTCAGGGAG ACTTAGCTTC CCCCCAGGAA ATATCACCTG CAATTTTAGC
AATAATCGGT AACAATGTGG TTAACCTTGT TAGTAAAGCT GACCTTTGAA AGCATTCTAT CTGTTTGACT TATTCTCTGG
GCTACAATGA CAAACCTATG GACAACACAT GCTAGTGTTG GTACGTATGG TAGAAGACCC AGATGCAACA TCAAACAAGT
GCCAAAGAAG CGTCATTTTG TACTTTTATT TATTTCCATA CAACATGGTA CATTCACCAC AAAATTTTAA TCCTGGTTTG
TGATGACCAA AATGGCCAAT GTGTTTTAGA ATGATTAGGC AGGTTATCTC AGTTCTTCCA CTGGATATGT TTTTAATATG
CACAACACAT CTGTAAATGG ACTGGAAAAT TATGTGATTT TCATGAAAGA TCTTCTATAT GACATTCATC AAAACGGAAA
TGCATATTTC AATTTCTCTA ATATAATTCT CTGTCTGGAT TTTTGTCCTA TGCTCCAACT CCAACATGCA TGCTGACAAA
AGTGAAACCT TTCCGACTTT GTCCTGACTT AAACATATTT TTTATTCACC CCCCTCAATC GATAAGACAA TAAATCAATA
TAACTTGTAT AATGATGATA TTGAGCGCAG TTTAGCTGGC CATGGATTCC GTTTGTGTTT CAAGATGAGG CATTGATTTT
GTAGGGATTT TTCATCAGAC TGTAAATGGT CTAATCATCA ATAACTAAAA TTGTACCTGC TTTTCACATT TGTTATTATA
AAAGCTCAAA CTATCGTAAT ATGAGGAGGC ACCACATTTT CTCCGAGTGG TCAAAATGTA CAACTCTAAT CAGAGGGAGA
AGAAATGAGT CAGCATTTGG TGTGCCCATA AATaagagaa aattccttat ataccattgg atgttaccct attcctctat
tgccattcaa aaattgACGT TTAATTATTT TTCACATTCT CATTTCTTGT TCCTCTTTCT TCTCCTTTCC TCTCTTCCTC
TCTCTCCTCA CCTGCTGTTT CCTTTTTATT TCTTCCTTCC TAGCCTGTTC TGTCTTCGAG GATGTTACCC TATTCCTCCA
TGGCCTTGTT CCTCTTTCTT CTCCTTTCCT CTCTTCCTCT CTCTCCTCAC CTGCTGTTTC CTTTTTATTT CTTCCTTCCT
AGCCTGTTCT GTCTTCAAGG TCTGCTGTAC TGAGCACCGT GGATGATTAC ATCAAGCCAG AATACCATGA AGTTGGGGCC
CATTGTCAAT AGAGACTGAG GTCAAAGCCA TAATGTTGGG GGACAAATAC AAAGAATGGC TGAAATTGAA GCCATGACGA
CGGGAAGAGC ACATTGGCAG CAGTGTGAGC TTGGCAGTGC ACAAATTGAG GCACGATGGC ACATGAAGTT AAAGCTCCTC
GTCCAAGGAT TAGGCTGTCT GCGCTTGAAA TCAGAACACA CTGGCAACAA AATCTAAGTT CCTTCCTCTC GTTCTAAACC
CAAGGTCCAT GGTGGCTAAC TGGCCATGAC CTTGAAGGCA GTGGTTGTGT TTGGGAATGG TGTGGATGTG TCTAGCAGCA
GTAGAAAGAC ATTAAGTCCG TCCACTGACA ACAATGCTTG GCTGCAGGGG GCTGCATCCA TGGCTGCCGA AATCAAAACT
TGAGGGTGGC AAAGCTTTTT TGGCTGTGGG GACGAGCTCA GTGGCAGCTG AATTTGTAAT CAATGGTACA TCGTTGGGGC
TGGGAGAGGT GAGGGAGGCA ACTAAATTAC ATGGGTGATT ATGTGATTGG GATAGGAGAG GGAAGTCCAG CAGTTGAGCC
GCTTAGAGTA CCTTGTGGAC CATGGTAGCG TGCCATCTGG CATGGTGGGT GAATAAGAGA GAGGAGTATT TAGTGCAGCT
GGCTGTAGGT TGATATTAGT GCTAGTAGAG TAGGGTATGG TCGTTTTATT TTTTATTGGT GGCACATTGG TAATGTTTTG
ATACTAAAAT GTACTAATGT TTCTCTTCCG CGTATTCGAG AAAAATGAAG AAGAGAGGAG AGCAGAAAGA GATTGGATGA
AGATGATAAG TGGCCGTGTA AGGGCAAGAA TAGGATTTTG CCAAGAAAAA AAAAACCTGA CCACTAACAA TGCGTCGTCC
TACCAGAGTA ATAAATGGAC TAGGGCAAGA AAGGGTTATT AAATATGGGT CGGTGGAAAA TAAGTGAACA TCAAATTTTA
GATGGTAAAT AGGGGATTTA AGTAACACTC AATGGTACAT AAGGAATTTT CTCAGTAAAA AAGGGAAGTT TACTAAATAG
ATATTATTAC TGTTATATTT GATTTGTTTA ATAACAAACA TAACCATATT CTCAATTTAG GTATTAGAGC ATTTTAAGCA
ATTTAACTGC ACAATCATGT GGTATCTATG ACTTGTTTTT ACTATTTTAC TATTTATTCT TTAGGAGTAG TTCACCTTTT
TTTGTTACAT TGATGATTCA GGTGGCCCCT AACACTAGAT CATTTTCTCT AGATAAATCA AAATCACAGG GTGGATTGGA
CTCTAGGAAG GATGCATTCA TCCCAAGGGA TGCGAATGGT CAACCTATTG CTGCACACAC TTTCACTTTT CGTGAACTTG
CTGCTGCCAC TAAGAACTTC AGACAAGATT GTCTATTGGG GGAGGGAGGT TTTGGCCGCG TATATAAAGG ACACTTGGAG
AATGGGCAGG TTTGTGTTCT GAAATATGTT TTTCGTGGTT GGGGATTTTT TGAATTCTCT ATGGTTAGCT ACTGTGCACT
TTTGGTAATT TGCGTACTAA AACACCACAT TATGGTTACT GCATTTCTTT TAACCCCCTA TGTGATCTGT GGAGCATTAG
AGGAGACATG TTTCCTTAAA GTCTTGATCG ATGAGCTTAC CAAATATGCA GGCTGTTGCA GTGAAGCAAC TTGATCGCAA
TGGACTTCAA GGAAATAGAG AGTTTCTGGT TGAAGTCCTT ATGCTCAGTC TATTGCACCA TGATAACCTG GTTAACCTAA
TTGGATACTG TGCTGATGGG GATCAACGTC TCCTTGTATA TGAGTTTATG CCATTGGGAT CACTTGAGGA TCATTTGCAT
GGTAAATTTG CTACTCTACT ACACTCATGA ACTCCTATTG TATTTGTATG CCTATGTCCT GTATATTCAA AGACACATGT
GGCATTATAC ATGCAGTATC TGTCAACTCA GCTTGCAAGT ACCTACATGT GTTTATTCTA TCGTTGTGAG CTCGTTATAA
CTCACACTTC CAACAGTATA AAGTTTCTTC CAGAAAAAGG AAAAAAAACA ACAGTTTTGT GGGTTATCCT GTATTAACTC
ACAATTAATA AATACTAGTT AAAATAATTT GCGTCGTGAA AGTGGTTTAC CAAACAGAAA CCTTACATTG TTGTTACTTC
AACTTTATTG TCTCCCACAT ATCCTGTCTC AAGTTTATAT ATCTAGAATA CCCTATGATG TAATTATGCT CAGATACTTG
TTCCATTGCT AAATCATGAA AACAAAACAT TGTGTCTATA ATCTGGACTT GATTTACTTA GCATTATGGT TTTTCGAAAC
CAACAGACTC TTATGTTTCC ATAAAAGTTG GTAATATGCA ACAACGATGT CTGCATCAGA CTCTTAAGCG CATTGTTTGT
TCATAAGACG TATTTAGTTT GTTTAAATTA ATTTGCATGA TTCATAAATG GCAACGTTTT GTACTTTTGT GTGTTAGATA
TTCCACCTGA CAAGGAACCT CTCGACTGGA ATACACGGAT GAAGATTGCT GCTGGTGCAG CCAAGGGCTT GGAATTCTTG
CATGACAAGG CAAATCCTCC TGTTATTTAC AGGGATTTCA AGTCATCGAA CATTCTTCTT GGTGAGGGAT ACCATCCAAA
ACTATCAGAC TTTGGCCTGG CAAAACTTGG CCCTGTTGGT GACAAAACTC ATGTTTCGAC ACGTGTTATG GGAACTTATG
GCTACTGTGC CCCAGAATAT GCGATGACTG GGCAGCTTAC TGTTAAATCT GATGTGTATA GTTTTGGTGT TGTGTTCCTT
GAACTGATTA CTGGCCGCAA AGCAATCGAC AACACCAAAC CACTTGGAGA GCAGAACCTA GTGGCATGGG TATGTTCATC
TATTGTCTAA ATTTTGTCAT AAGCTTGATG GTTGCCTATC GATATATCGT AGCAAATTCA TTTATTTTAC AATTTCTTGG
ATGAAGCATA GGTACTAAAA CATTGTAGTT AAGGAAAAAA TGAACTAAAA GATTTAAAAG TATAACTAGG ATGGGAGTAA
ACTGTTTTTC CTAGCTTGGA AAATGAAATA ATCCACTAGC CAAAAAGCTA ATGTCTCAAA AGACATTTTT GGAAATTGTG
CAAGGTTAGT CTTTTATTTA CTTCTCAGAT CATATAACCT TTTCTAACTG AACCTTGAGA CTAACATTTA TATCAAATGC
CTCATTTGTT AATTCATATG GCATTTCCCT CGTATTTTCT GGAACGCAAT CTTCGAAAGC CTTACACTGT AGCACATATA
ACATGCAATC TTCGAAAACT ATTTCTATTC AGCTATTGTT ATTGCTTATT CATCCAGAAA CAGTAACTTT TCATTAGGCA
GTTTGACCAG GGTCAGCCCT TCTTGGCCTT GGATTTATTG TCAGTTCCAA ACCAATTTTG ATTTTTTAAG AATGATTTTA
CATTTTTTTT TACTTTTCTT ATTAGCAATC ATGAAAGGAG AAAGCAATTA GAGCGATGAA GAAAACCCCT AAAATTGATC
ATGAAGTCAA AAGTTTAAAT TAAATTCAGC TTAGAATTAT GATCTGGAGC TGAGGAGCTC AGCCAAGCGG GTAAACCAGC
TGGTAAAGTT TGTTGATTTG ACTTTATAAT CTAAACCAGC TGAGCATACT TGTATAATTG TCAAGTTTAC CTCAATATCG
GATTCCACCT TGGTTCTGAA ATCCTCTTAT AATACAAGAA CGGTGTCTCT TATCAAGTGA GCGTAAAGTA GTTTTTTTTT
GGGGGGGAAA GTAATTATTT TATTTTGATT GTTAACACCA GTGGAATTAG GTTATTTATT ATTGACCATT GACACTAGTT
CTTGTGATAT CTTGATCACT CCTTTATCTA TACTAATTTA TTACCTGACA ATATATTTTC TTGCAGTTGC AGATTTAAAT
AAGCTTTACT TTCGATAAAT ATTCAGATAA CACAATTTTG GATATCTGAT ACCATTGATC TTATTTGCAG GCCCGTCCCC
TGTTTAAAGA CCGCAGGAAA TTTCCTAAAA TGGCTGATCC ATTACTTGCG GGCCGATTTC CTATGCGGGG CCTGTATCAG
GCTTTAGCAG TTGCTGCAAT GTGTTTGCAG GAGCAAGCTG CCACTAGGCC TTTTATAGGA GATGTGGTCA CTGCTCTTTC
ATATCTTGCT TCCCAGACAT ATGATCCAAA TACACCTGTT CAGCACAGTC GGAGCAATGC ATCTACCCCT AGGGCCAGAA
ACCGTGTTGG TGCGAATTTT GACCAGCGTC GTCTTCACTC ACCAAATCAC CAACAATCTC CAGATTTAAG GAAAGAAGGC
ACCACAACAT CAAAATATGA AGCTGAGGTT AGCAGGACTA ATTCTGGCAG TGGCTCTGGT CGACGAGCTG GCTTGGACAG
CATGGATGTG ACAGGTTCAC AGATGGGTAG TCCTGCTCAC GCAGGAAGGA AGAGGGAATC ATCGCGGAGT ACTGATAGGC
AGCGTGCAGT CGCAGAGGCC AAAACATGGG GGGAGAATTC AAGAGAAAGA AAGTGGCCAA ATGCTCGTGG CAGCTTTGAT
AGTACAAATG AGTAAACCTC TGAAGCAGAA GGTTCAGTTA AGTCGTCATT CTAGGGGAAA AAAAAAGATG AATCACTTGC
AGAACCCAAC TGGGTCGAAT TAGGTACATG GGGCATTTTC GCTCCATCTC GGCTCTGCGG TCTATGTGAA TAGAGCTTCT
CTTTTTCTTT TTTCTGTCCT GGAGACACCA CCGCTGCTTC AGAGCTCTCC TCTCGTCCAT ACGAATAGCA TCACCGCGAT
CTCATCGTCG ACGCGCCTAT TCCTGGCGTC CATTCCTCGT GATTGATCAT GCAAATGTGC CTTTTATTCA TCATGAAGAC
AGAAACACCG TTTGGCTGGA AATGTAGGTA GAAAGCAAAA GAGAAAATTT GCTCTGGAGC TATCCATTGG GTATCTCATG
TCGATGTTGT TGCATGATGA GTGTCAGCGG CTGCACCATT GTTCCTGAGT GTTCTAGCTC TATGTGAAGT GAAGTCTGCG
TACCGAGGGA TGTGATGTTC TTTTTTCTTT TCTTTTCTTT TCTTTTTGTC TCAATGGTTT GTACCTAGGG GGTACGGCAT
TTTACCTGTG TTTCATACAC CTGTCATTTG 

Locus: Os05g0372100

Loading...

Locus: Os05g0372100

Loading...