Os05t0372100-02

Locus

Os05g0372100

Description

Similar to Receptor protein kinase-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK185

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 185

Oryzabase Gene Symbol Synonym(s)

OsRLCK185

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 185

Transcript Evidence

AK111832 (DDBJ, Best hit)

Protein Evidence

XP_002871824.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine-threonine/tyrosine-protein kinase (IPR001245)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Full-length cDNA

J023128O09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0372100-02)

RiceXPro (AK111832)

Others

Oryzabase (12338)

KEGG (Os05t0372100-02)

Transcript

2298 bp

>Os05t0372100-02 Similar to Receptor protein kinase-like protein.
ACTCTTGCCCCTGGGCTGACTTTTGCCCTCCCTTGGGCATCCATCTCCTCTCCCTCCCTC
CCCTCCCCTCCCATCCCTACCCCCAAAATCGCCGACCGACCGCCCCCAAATCCCATCCAA
GAGCCGTCGCCTCCTCCAAAGATCGGATTTCGAGACCCCCCAGATCGGGGGGAGAGATCC
CCGTGTCGTCTGGTGTGGTGGGTCGGCCTCCGCCCCCCGGCCGCCGCGCTTCTCTTGATC
TTTCTTTCTTTTTTTTGATTTTTTTGCGTTTCCCCTCCGGGAGAGGGGAGGGGAGGAGGG
TTCTTGGATGGGCTGCTTTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGG
CGGCGGCGGGCGCAAGGACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGA
TAAATCAAAATCACAGGGTGGATTGGACTCTAGGAAGGATGCATTCATCCCAAGGGATGC
GAATGGTCAACCTATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAA
GAACTTCAGACAAGATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACA
CTTGGAGAATGGGCAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAA
TAGAGAGTTTCTGGTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAA
CCTAATTGGATACTGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATT
GGGATCACTTGAGGATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAA
TACACGGATGAAGATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGC
AAATCCTCCTGTTATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGAATATGCGAT
GACTGGGCAGCTTACTGTTAAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACT
GATTACTGGCCGCAAAGCAATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGC
ATGGGCCCGTCCCCTGTTTAAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACT
TGCGGGCCGATTTCCTATGCGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTT
GCAGGAGCAAGCTGCCACTAGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCT
TGCTTCCCAGACATATGATCCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTAC
CCCTAGGGCCAGAAACCGTGTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAA
TCACCAACAATCTCCAGATTTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGA
GGTTAGCAGGACTAATTCTGGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGA
TGTGACAGGTTCACAGATGGGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCG
GAGTACTGATAGGCAGCGTGCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGA
AAGAAAGTGGCCAAATGCTCGTGGCAGCTTTGATAGTACAAATGAGTAAACCTCTGAAGC
AGAAGGTTCAGTTAAGTCGTCATTCTAGGGGAAAAAAAAAGATGAATCACTTGCAGAACC
CAACTGGGTCGAATTAGGTACATGGGGCATTTTCGCTCCATCTCGGCTCTGCGGTCTATG
TGAATAGAGCTTCTCTTTTTCTTTTTTCTGTCCTGGAGACACCACCGCTGCTTCAGAGCT
CTCCTCTCGTCCATACGAATAGCATCACCGCGATCTCATCGTCGACGCGCCTATTCCTGG
CGTCCATTCCTCGTGATTGATCATGCAAATGTGCCTTTTATTCATCATGAAGACAGAAAC
ACCGTTTGGCTGGAAATGTAGGTAGAAAGCAAAAGAGAAAATTTGCTCTGGAGCTATCCA
TTGGGTATCTCATGTCGATGTTGTTGCATGATGAGTGTCAGCGGCTGCACCATTGTTCCT
GAGTGTTCTAGCTCTATGTGAAGTGAAGTCTGCGTACCGAGGGATGTGATGTTCTTTTTT
CTTTTCTTTTCTTTTCTTTTTGTCTCAATGGTTTGTACCTAGGGGGTACGGCATTTTACC
TGTGTTTCATACACCTGTCATTTGACAATTTCATGTCGGAGTTATCTGTTGTTTTATCTC
TACGAGTAAGCTGTTCTT

CDS

1362 bp

>Os05t0372100-02 Similar to Receptor protein kinase-like protein.
ATGGGCTGCTTTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGC
GGGCGCAAGGACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGATAAATCA
AAATCACAGGGTGGATTGGACTCTAGGAAGGATGCATTCATCCCAAGGGATGCGAATGGT
CAACCTATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTC
AGACAAGATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAG
AATGGGCAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAG
TTTCTGGTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATT
GGATACTGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCA
CTTGAGGATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGG
ATGAAGATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCT
CCTGTTATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGAATATGCGATGACTGGG
CAGCTTACTGTTAAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACT
GGCCGCAAAGCAATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCC
CGTCCCCTGTTTAAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGC
CGATTTCCTATGCGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAG
CAAGCTGCCACTAGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCC
CAGACATATGATCCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGG
GCCAGAAACCGTGTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAA
CAATCTCCAGATTTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAGGTTAGC
AGGACTAATTCTGGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACA
GGTTCACAGATGGGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACT
GATAGGCAGCGTGCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAG
TGGCCAAATGCTCGTGGCAGCTTTGATAGTACAAATGAGTAA

Protein

454 aa

>Os05t0372100-02 Similar to Receptor protein kinase-like protein.
MGCFPCFGSGGKGEAKKGGGGRKDGGSADRRVARVGSDKSKSQGGLDSRKDAFIPRDANG
QPIAAHTFTFRELAAATKNFRQDCLLGEGGFGRVYKGHLENGQAVAVKQLDRNGLQGNRE
FLVEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTR
MKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLEYAMTGQLTVKSDVYSFGVVFLELIT
GRKAIDNTKPLGEQNLVAWARPLFKDRRKFPKMADPLLAGRFPMRGLYQALAVAAMCLQE
QAATRPFIGDVVTALSYLASQTYDPNTPVQHSRSNASTPRARNRVGANFDQRRLHSPNHQ
QSPDLRKEGTTTSKYEAEVSRTNSGSGSGRRAGLDSMDVTGSQMGSPAHAGRKRESSRST
DRQRAVAEAKTWGENSRERKWPNARGSFDSTNE*

5'UTR

chr05:17922844..17923150 (+ strand) : 307 bp

CDS

chr05:17923151..17923262 (+ strand) : 112 bp

chr05:17926331..17926527 (+ strand) : 197 bp

chr05:17926730..17926919 (+ strand) : 190 bp

chr05:17927556..17927699 (+ strand) : 144 bp

chr05:17927814..17927947 (+ strand) : 134 bp

chr05:17929069..17929653 (+ strand) : 585 bp

3'UTR

chr05:17929654..17930282 (+ strand) : 629 bp

FASTA

>Os05t0372100-02 class=Sequence position=chr05:17922844..17930282 (+ strand)
ACTCTTGCCC CTGGGCTGAC TTTTGCCCTC CCTTGGGCAT CCATCTCCTC TCCCTCCCTC CCCTCCCCTC CCATCCCTAC
CCCCAAAATC GCCGACCGAC CGCCCCCAAA TCCCATCCAA GAGCCGTCGC CTCCTCCAAA GATCGGATTT CGAGACCCCC
CAGATCGGGG GGAGAGATCC CCGTGTCGTC TGGTGTGGTG GGTCGGCCTC CGCCCCCCGG CCGCCGCGCT TCTCTTGATC
TTTCTTTCTT TTTTTTGATT TTTTTGCGTT TCCCCTCCGG GAGAGGGGAG GGGAGGAGGG TTCTTGGATG GGCTGCTTTC
CGTGCTTCGG GTCGGGCGGC AAGGGGGAGG CGAAGAAGGG CGGCGGCGGG CGCAAGGACG GCGGCTCGGC GGATCGCCGC
GTCGCCCGGG TCGGATCAGG TGCGGTTCTT GTGGTGGGGG TGTGGGGGGA AAGGGTTGGA TCTTGGGGGT GGTTTTGTTT
GTAGGAAATG GTAGCTGATG ATTTGCTCCG ATGTGGTCAG TTCATGAGAT TTTGGTGTGA TTCGGATCAA TGGGCGATTC
GAACTTTGTG CTAACACGTA TTCGATTTTA GCGAATGGGT TGGAGACAAT CTCGAGGTTT CGGCGCGGAT GGTGGTGTGG
TGGTATTTGG GAGATTTTCC TTTTGTTTGT GTTAGGCTAT TTTGATGGTA TGAGTGCTTG ATGTTAGTAT GCGTTACTTA
TCTATTTGTA GTTTATCTGT GATGTTTTGG ATCGGTAAGC TAGGTCATCC TTTTTGGTTT ATCCTATAAC TGATAGAAGC
CAGCGGCTTT AGTGATATTT TCGTGGATGG ATAGGAGGTT GTGGATGGAT AGGAGGTTGC AGTATGACTC TTGCAGTATT
GGATTCAGGG GGACAAGGAA ATTAATGTTT CACTTCTTGT TTATACTGAT AAATGATGTG GAAGTACTTG CAAGACTGCT
ATAGATGTAT ATGAAGAAAT GGACGAGTCA GGGAGACTTA GCTTCCCCCC AGGAAATATC ACCTGCAATT TTAGCAATAA
TCGGTAACAA TGTGGTTAAC CTTGTTAGTA AAGCTGACCT TTGAAAGCAT TCTATCTGTT TGACTTATTC TCTGGGCTAC
AATGACAAAC CTATGGACAA CACATGCTAG TGTTGGTACG TATGGTAGAA GACCCAGATG CAACATCAAA CAAGTGCCAA
AGAAGCGTCA TTTTGTACTT TTATTTATTT CCATACAACA TGGTACATTC ACCACAAAAT TTTAATCCTG GTTTGTGATG
ACCAAAATGG CCAATGTGTT TTAGAATGAT TAGGCAGGTT ATCTCAGTTC TTCCACTGGA TATGTTTTTA ATATGCACAA
CACATCTGTA AATGGACTGG AAAATTATGT GATTTTCATG AAAGATCTTC TATATGACAT TCATCAAAAC GGAAATGCAT
ATTTCAATTT CTCTAATATA ATTCTCTGTC TGGATTTTTG TCCTATGCTC CAACTCCAAC ATGCATGCTG ACAAAAGTGA
AACCTTTCCG ACTTTGTCCT GACTTAAACA TATTTTTTAT TCACCCCCCT CAATCGATAA GACAATAAAT CAATATAACT
TGTATAATGA TGATATTGAG CGCAGTTTAG CTGGCCATGG ATTCCGTTTG TGTTTCAAGA TGAGGCATTG ATTTTGTAGG
GATTTTTCAT CAGACTGTAA ATGGTCTAAT CATCAATAAC TAAAATTGTA CCTGCTTTTC ACATTTGTTA TTATAAAAGC
TCAAACTATC GTAATATGAG GAGGCACCAC ATTTTCTCCG AGTGGTCAAA ATGTACAACT CTAATCAGAG GGAGAAGAAA
TGAGTCAGCA TTTGGTGTGC CCATAAATaa gagaaaattc cttatatacc attggatgtt accctattcc tctattgcca
ttcaaaaatt gACGTTTAAT TATTTTTCAC ATTCTCATTT CTTGTTCCTC TTTCTTCTCC TTTCCTCTCT TCCTCTCTCT
CCTCACCTGC TGTTTCCTTT TTATTTCTTC CTTCCTAGCC TGTTCTGTCT TCGAGGATGT TACCCTATTC CTCCATGGCC
TTGTTCCTCT TTCTTCTCCT TTCCTCTCTT CCTCTCTCTC CTCACCTGCT GTTTCCTTTT TATTTCTTCC TTCCTAGCCT
GTTCTGTCTT CAAGGTCTGC TGTACTGAGC ACCGTGGATG ATTACATCAA GCCAGAATAC CATGAAGTTG GGGCCCATTG
TCAATAGAGA CTGAGGTCAA AGCCATAATG TTGGGGGACA AATACAAAGA ATGGCTGAAA TTGAAGCCAT GACGACGGGA
AGAGCACATT GGCAGCAGTG TGAGCTTGGC AGTGCACAAA TTGAGGCACG ATGGCACATG AAGTTAAAGC TCCTCGTCCA
AGGATTAGGC TGTCTGCGCT TGAAATCAGA ACACACTGGC AACAAAATCT AAGTTCCTTC CTCTCGTTCT AAACCCAAGG
TCCATGGTGG CTAACTGGCC ATGACCTTGA AGGCAGTGGT TGTGTTTGGG AATGGTGTGG ATGTGTCTAG CAGCAGTAGA
AAGACATTAA GTCCGTCCAC TGACAACAAT GCTTGGCTGC AGGGGGCTGC ATCCATGGCT GCCGAAATCA AAACTTGAGG
GTGGCAAAGC TTTTTTGGCT GTGGGGACGA GCTCAGTGGC AGCTGAATTT GTAATCAATG GTACATCGTT GGGGCTGGGA
GAGGTGAGGG AGGCAACTAA ATTACATGGG TGATTATGTG ATTGGGATAG GAGAGGGAAG TCCAGCAGTT GAGCCGCTTA
GAGTACCTTG TGGACCATGG TAGCGTGCCA TCTGGCATGG TGGGTGAATA AGAGAGAGGA GTATTTAGTG CAGCTGGCTG
TAGGTTGATA TTAGTGCTAG TAGAGTAGGG TATGGTCGTT TTATTTTTTA TTGGTGGCAC ATTGGTAATG TTTTGATACT
AAAATGTACT AATGTTTCTC TTCCGCGTAT TCGAGAAAAA TGAAGAAGAG AGGAGAGCAG AAAGAGATTG GATGAAGATG
ATAAGTGGCC GTGTAAGGGC AAGAATAGGA TTTTGCCAAG AAAAAAAAAA CCTGACCACT AACAATGCGT CGTCCTACCA
GAGTAATAAA TGGACTAGGG CAAGAAAGGG TTATTAAATA TGGGTCGGTG GAAAATAAGT GAACATCAAA TTTTAGATGG
TAAATAGGGG ATTTAAGTAA CACTCAATGG TACATAAGGA ATTTTCTCAG TAAAAAAGGG AAGTTTACTA AATAGATATT
ATTACTGTTA TATTTGATTT GTTTAATAAC AAACATAACC ATATTCTCAA TTTAGGTATT AGAGCATTTT AAGCAATTTA
ACTGCACAAT CATGTGGTAT CTATGACTTG TTTTTACTAT TTTACTATTT ATTCTTTAGG AGTAGTTCAC CTTTTTTTGT
TACATTGATG ATTCAGGTGG CCCCTAACAC TAGATCATTT TCTCTAGATA AATCAAAATC ACAGGGTGGA TTGGACTCTA
GGAAGGATGC ATTCATCCCA AGGGATGCGA ATGGTCAACC TATTGCTGCA CACACTTTCA CTTTTCGTGA ACTTGCTGCT
GCCACTAAGA ACTTCAGACA AGATTGTCTA TTGGGGGAGG GAGGTTTTGG CCGCGTATAT AAAGGACACT TGGAGAATGG
GCAGGTTTGT GTTCTGAAAT ATGTTTTTCG TGGTTGGGGA TTTTTTGAAT TCTCTATGGT TAGCTACTGT GCACTTTTGG
TAATTTGCGT ACTAAAACAC CACATTATGG TTACTGCATT TCTTTTAACC CCCTATGTGA TCTGTGGAGC ATTAGAGGAG
ACATGTTTCC TTAAAGTCTT GATCGATGAG CTTACCAAAT ATGCAGGCTG TTGCAGTGAA GCAACTTGAT CGCAATGGAC
TTCAAGGAAA TAGAGAGTTT CTGGTTGAAG TCCTTATGCT CAGTCTATTG CACCATGATA ACCTGGTTAA CCTAATTGGA
TACTGTGCTG ATGGGGATCA ACGTCTCCTT GTATATGAGT TTATGCCATT GGGATCACTT GAGGATCATT TGCATGGTAA
ATTTGCTACT CTACTACACT CATGAACTCC TATTGTATTT GTATGCCTAT GTCCTGTATA TTCAAAGACA CATGTGGCAT
TATACATGCA GTATCTGTCA ACTCAGCTTG CAAGTACCTA CATGTGTTTA TTCTATCGTT GTGAGCTCGT TATAACTCAC
ACTTCCAACA GTATAAAGTT TCTTCCAGAA AAAGGAAAAA AAACAACAGT TTTGTGGGTT ATCCTGTATT AACTCACAAT
TAATAAATAC TAGTTAAAAT AATTTGCGTC GTGAAAGTGG TTTACCAAAC AGAAACCTTA CATTGTTGTT ACTTCAACTT
TATTGTCTCC CACATATCCT GTCTCAAGTT TATATATCTA GAATACCCTA TGATGTAATT ATGCTCAGAT ACTTGTTCCA
TTGCTAAATC ATGAAAACAA AACATTGTGT CTATAATCTG GACTTGATTT ACTTAGCATT ATGGTTTTTC GAAACCAACA
GACTCTTATG TTTCCATAAA AGTTGGTAAT ATGCAACAAC GATGTCTGCA TCAGACTCTT AAGCGCATTG TTTGTTCATA
AGACGTATTT AGTTTGTTTA AATTAATTTG CATGATTCAT AAATGGCAAC GTTTTGTACT TTTGTGTGTT AGATATTCCA
CCTGACAAGG AACCTCTCGA CTGGAATACA CGGATGAAGA TTGCTGCTGG TGCAGCCAAG GGCTTGGAAT TCTTGCATGA
CAAGGCAAAT CCTCCTGTTA TTTACAGGGA TTTCAAGTCA TCGAACATTC TTCTTGGTGA GGGATACCAT CCAAAACTAT
CAGACTTTGG CCTGGCAAAA CTTGGCCCTG TTGGTGACAA AACTCATGTT TCGACACGTG TTATGGGAAC TTATGGCTAC
TGTGCCCCAG AATATGCGAT GACTGGGCAG CTTACTGTTA AATCTGATGT GTATAGTTTT GGTGTTGTGT TCCTTGAACT
GATTACTGGC CGCAAAGCAA TCGACAACAC CAAACCACTT GGAGAGCAGA ACCTAGTGGC ATGGGTATGT TCATCTATTG
TCTAAATTTT GTCATAAGCT TGATGGTTGC CTATCGATAT ATCGTAGCAA ATTCATTTAT TTTACAATTT CTTGGATGAA
GCATAGGTAC TAAAACATTG TAGTTAAGGA AAAAATGAAC TAAAAGATTT AAAAGTATAA CTAGGATGGG AGTAAACTGT
TTTTCCTAGC TTGGAAAATG AAATAATCCA CTAGCCAAAA AGCTAATGTC TCAAAAGACA TTTTTGGAAA TTGTGCAAGG
TTAGTCTTTT ATTTACTTCT CAGATCATAT AACCTTTTCT AACTGAACCT TGAGACTAAC ATTTATATCA AATGCCTCAT
TTGTTAATTC ATATGGCATT TCCCTCGTAT TTTCTGGAAC GCAATCTTCG AAAGCCTTAC ACTGTAGCAC ATATAACATG
CAATCTTCGA AAACTATTTC TATTCAGCTA TTGTTATTGC TTATTCATCC AGAAACAGTA ACTTTTCATT AGGCAGTTTG
ACCAGGGTCA GCCCTTCTTG GCCTTGGATT TATTGTCAGT TCCAAACCAA TTTTGATTTT TTAAGAATGA TTTTACATTT
TTTTTTACTT TTCTTATTAG CAATCATGAA AGGAGAAAGC AATTAGAGCG ATGAAGAAAA CCCCTAAAAT TGATCATGAA
GTCAAAAGTT TAAATTAAAT TCAGCTTAGA ATTATGATCT GGAGCTGAGG AGCTCAGCCA AGCGGGTAAA CCAGCTGGTA
AAGTTTGTTG ATTTGACTTT ATAATCTAAA CCAGCTGAGC ATACTTGTAT AATTGTCAAG TTTACCTCAA TATCGGATTC
CACCTTGGTT CTGAAATCCT CTTATAATAC AAGAACGGTG TCTCTTATCA AGTGAGCGTA AAGTAGTTTT TTTTTGGGGG
GGAAAGTAAT TATTTTATTT TGATTGTTAA CACCAGTGGA ATTAGGTTAT TTATTATTGA CCATTGACAC TAGTTCTTGT
GATATCTTGA TCACTCCTTT ATCTATACTA ATTTATTACC TGACAATATA TTTTCTTGCA GTTGCAGATT TAAATAAGCT
TTACTTTCGA TAAATATTCA GATAACACAA TTTTGGATAT CTGATACCAT TGATCTTATT TGCAGGCCCG TCCCCTGTTT
AAAGACCGCA GGAAATTTCC TAAAATGGCT GATCCATTAC TTGCGGGCCG ATTTCCTATG CGGGGCCTGT ATCAGGCTTT
AGCAGTTGCT GCAATGTGTT TGCAGGAGCA AGCTGCCACT AGGCCTTTTA TAGGAGATGT GGTCACTGCT CTTTCATATC
TTGCTTCCCA GACATATGAT CCAAATACAC CTGTTCAGCA CAGTCGGAGC AATGCATCTA CCCCTAGGGC CAGAAACCGT
GTTGGTGCGA ATTTTGACCA GCGTCGTCTT CACTCACCAA ATCACCAACA ATCTCCAGAT TTAAGGAAAG AAGGCACCAC
AACATCAAAA TATGAAGCTG AGGTTAGCAG GACTAATTCT GGCAGTGGCT CTGGTCGACG AGCTGGCTTG GACAGCATGG
ATGTGACAGG TTCACAGATG GGTAGTCCTG CTCACGCAGG AAGGAAGAGG GAATCATCGC GGAGTACTGA TAGGCAGCGT
GCAGTCGCAG AGGCCAAAAC ATGGGGGGAG AATTCAAGAG AAAGAAAGTG GCCAAATGCT CGTGGCAGCT TTGATAGTAC
AAATGAGTAA ACCTCTGAAG CAGAAGGTTC AGTTAAGTCG TCATTCTAGG GGAAAAAAAA AGATGAATCA CTTGCAGAAC
CCAACTGGGT CGAATTAGGT ACATGGGGCA TTTTCGCTCC ATCTCGGCTC TGCGGTCTAT GTGAATAGAG CTTCTCTTTT
TCTTTTTTCT GTCCTGGAGA CACCACCGCT GCTTCAGAGC TCTCCTCTCG TCCATACGAA TAGCATCACC GCGATCTCAT
CGTCGACGCG CCTATTCCTG GCGTCCATTC CTCGTGATTG ATCATGCAAA TGTGCCTTTT ATTCATCATG AAGACAGAAA
CACCGTTTGG CTGGAAATGT AGGTAGAAAG CAAAAGAGAA AATTTGCTCT GGAGCTATCC ATTGGGTATC TCATGTCGAT
GTTGTTGCAT GATGAGTGTC AGCGGCTGCA CCATTGTTCC TGAGTGTTCT AGCTCTATGT GAAGTGAAGT CTGCGTACCG
AGGGATGTGA TGTTCTTTTT TCTTTTCTTT TCTTTTCTTT TTGTCTCAAT GGTTTGTACC TAGGGGGTAC GGCATTTTAC
CTGTGTTTCA TACACCTGTC ATTTGACAAT TTCATGTCGG AGTTATCTGT TGTTTTATCT CTACGAGTAA GCTGTTCTT

Locus: Os05g0372100

Loading...

Locus: Os05g0372100

Loading...