Os05t0372100-03

Locus

Os05g0372100

Description

Hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK185

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 185

Oryzabase Gene Symbol Synonym(s)

OsRLCK185

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 185

Transcript Evidence

AK107148 (DDBJ, Best hit)

Protein Evidence

longestORF

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

002-124-D11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0372100-03)

Others

Oryzabase (12338)

Transcript

1076 bp

>Os05t0372100-03 Hypothetical protein.
GACTTTTGCCCTCCCTTGGGCATCCATCTCCTCTCCCTCCCTCCCCTCCCCTCCCATCCC
TACCCCCAAAATCGCCGACCGACCGCCCCCAAATCCCATCCAAGAGCCGTCGCCTCCTCC
AAAGATCGGATTTCGAGACCCCCCAGATCGGGGGGAGAGATCCCCGTGTCGTCTGGTGTG
GTGGGTCGGCCTCCGCCCCCCGGCCGCCGCGCTTCTCTTGATCTTTCTTTCTTTTTTTTG
ATTTTTTTGCGTTTCCCCTCCGGGAGAGGGGAGGGGAGGAGGGTTCTTGGATGGGCTGCT
TTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGCGGGCGCAAGG
ACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGGTGCGGTTCTTGTGGTGG
GGGTGTGGGGGGAAAGGGTTGGATCTTGGGGGTGGTTTTGTTTGTAGGAAATGGTAGCTG
ATGATTTGCTCCGATGTGGTCAGTTCATGAGATTTTGGTGTGATTCGGATCAATGGGCGA
TTCGAACTTTGTGCTAACACGTATTCGATTTTAGCGAATGGGTTGGAGACAATCTCGAGG
TTTCGGCGCGGATGGTGGTGTGGTGGTATTTGGGAGATTTTCCTTTTGTTTGTGTTAGGC
TATTTTGATGGTATGAGTGCTTGATGTTAGTATGCGTTACTTATCTATTTGTAGTTTATC
TGTGATGTTTTGGATCGGTAAGCTAGGTCATCCTTTTTGGTTTATCCTATAACTGATAGA
AGCCAGCGGCTTTAGTGATATTTTCGTGGATGGATAGGAGGTTGTGGATGGATAGGAGGT
TGCAGTATGACTCTTGCAGTATTGGATTCAGGGGGACAAGGAAATTAATGTTTCACTTCT
TGTTTATACTGATAAATGATGTGGAAGTACTTGCAAGACTGCTATAGATGTATATGAAGA
AATGGACGAGTCAGGGAGACTTAGCTTCCCCCCAGGAAATATCACCTGCAATTTTAGCAA
TAATCGGTAACAATGTGGTTAACCTTGTTAGTAAAGCTGACCTTTGAAAGCATTCT

CDS

477 bp

>Os05t0372100-03 Hypothetical protein.
GACTTTTGCCCTCCCTTGGGCATCCATCTCCTCTCCCTCCCTCCCCTCCCCTCCCATCCC
TACCCCCAAAATCGCCGACCGACCGCCCCCAAATCCCATCCAAGAGCCGTCGCCTCCTCC
AAAGATCGGATTTCGAGACCCCCCAGATCGGGGGGAGAGATCCCCGTGTCGTCTGGTGTG
GTGGGTCGGCCTCCGCCCCCCGGCCGCCGCGCTTCTCTTGATCTTTCTTTCTTTTTTTTG
ATTTTTTTGCGTTTCCCCTCCGGGAGAGGGGAGGGGAGGAGGGTTCTTGGATGGGCTGCT
TTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGCGGGCGCAAGG
ACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGGTGCGGTTCTTGTGGTGG
GGGTGTGGGGGGAAAGGGTTGGATCTTGGGGGTGGTTTTGTTTGTAGGAAATGGTAG

Protein

159 aa

>Os05t0372100-03 Hypothetical protein.
DFCPPLGIHLLSLPPLPSHPYPQNRRPTAPKSHPRAVASSKDRISRPPRSGGEIPVSSGV
VGRPPPPGRRASLDLSFFFLIFLRFPSGRGEGRRVLGWAAFRASGRAARGRRRRAAAGAR
TAARRIAASPGSDQVRFLWWGCGGKGLDLGGGFVCRKW*

CDS

chr05:17922861..17923337 (+ strand) : 477 bp

3'UTR

chr05:17923338..17923936 (+ strand) : 599 bp

FASTA

>Os05t0372100-03 class=Sequence position=chr05:17922861..17923936 (+ strand)
GACTTTTGCC CTCCCTTGGG CATCCATCTC CTCTCCCTCC CTCCCCTCCC CTCCCATCCC TACCCCCAAA ATCGCCGACC
GACCGCCCCC AAATCCCATC CAAGAGCCGT CGCCTCCTCC AAAGATCGGA TTTCGAGACC CCCCAGATCG GGGGGAGAGA
TCCCCGTGTC GTCTGGTGTG GTGGGTCGGC CTCCGCCCCC CGGCCGCCGC GCTTCTCTTG ATCTTTCTTT CTTTTTTTTG
ATTTTTTTGC GTTTCCCCTC CGGGAGAGGG GAGGGGAGGA GGGTTCTTGG ATGGGCTGCT TTCCGTGCTT CGGGTCGGGC
GGCAAGGGGG AGGCGAAGAA GGGCGGCGGC GGGCGCAAGG ACGGCGGCTC GGCGGATCGC CGCGTCGCCC GGGTCGGATC
AGGTGCGGTT CTTGTGGTGG GGGTGTGGGG GGAAAGGGTT GGATCTTGGG GGTGGTTTTG TTTGTAGGAA ATGGTAGCTG
ATGATTTGCT CCGATGTGGT CAGTTCATGA GATTTTGGTG TGATTCGGAT CAATGGGCGA TTCGAACTTT GTGCTAACAC
GTATTCGATT TTAGCGAATG GGTTGGAGAC AATCTCGAGG TTTCGGCGCG GATGGTGGTG TGGTGGTATT TGGGAGATTT
TCCTTTTGTT TGTGTTAGGC TATTTTGATG GTATGAGTGC TTGATGTTAG TATGCGTTAC TTATCTATTT GTAGTTTATC
TGTGATGTTT TGGATCGGTA AGCTAGGTCA TCCTTTTTGG TTTATCCTAT AACTGATAGA AGCCAGCGGC TTTAGTGATA
TTTTCGTGGA TGGATAGGAG GTTGTGGATG GATAGGAGGT TGCAGTATGA CTCTTGCAGT ATTGGATTCA GGGGGACAAG
GAAATTAATG TTTCACTTCT TGTTTATACT GATAAATGAT GTGGAAGTAC TTGCAAGACT GCTATAGATG TATATGAAGA
AATGGACGAG TCAGGGAGAC TTAGCTTCCC CCCAGGAAAT ATCACCTGCA ATTTTAGCAA TAATCGGTAA CAATGTGGTT
AACCTTGTTA GTAAAGCTGA CCTTTGAAAG CATTCT

Locus: Os05g0372100

Loading...

Locus: Os05g0372100

Loading...