Os05t0372100-04

Locus

Os05g0372100

Description

Similar to protein kinase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK185

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 185

Oryzabase Gene Symbol Synonym(s)

OsRLCK185

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 185

Transcript Evidence

AK102474 (DDBJ, Best hit)

Protein Evidence

XP_002871824.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Full-length cDNA

J033094H16 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0372100-04)

RiceXPro (AK102474)

Others

Oryzabase (12338)

KEGG (Os05t0372100-04)

Transcript

2244 bp

>Os05t0372100-04 Similar to protein kinase family protein.
GGATTTCGAGACCCCCCAGATCGGGGGGAGAGATCCCCGTGTCGTCTGGTGTGGTGGGTC
GGCCTCCGCCCCCCGGCCGCCGCGCTTCTCTTGATCTTTCTTTCTTTTTTTTGATTTTTT
TGCGTTTCCCCTCCGGGAGAGGGGAGGGGAGGAGGGTTCTTGGATGGGCTGCTTTCCGTG
CTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGCGGGCGCAAGGACGGCGG
CTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGATAAATCAAAATCACAGGGTGGATT
GGACTCTAGGAAGGATGCATTCATCCCAAGGGATGCGAATGGTCAACCTATTGCTGCACA
CACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTCAGACAAGATTGTCTATT
GGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAGAATGGGCAGGCTGTTGC
AGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAGTTTCTGGTTGAAGTCCT
TATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATTGGATACTGTGCTGATGG
GGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCACTTGAGGATCATTTGCA
TGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGGATGAAGATTGCTGCTGG
TGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCTCCTGTTATTTACAGGGA
TTTCAAGTCATCGAACATTCTTCTTGGTGAGGGATACCATCCAAAACTATCAGACTTTGG
CCTGGCAAAACTTGGCCCTGTTGGTGACAAAACTCATGTTTCGACACGTGTTATGGGAAC
TTATGGCTACTGTGCCCCAGAATATGCGATGACTGGGCAGCTTACTGTTAAATCTGATGT
GTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACTGGCCGCAAAGCAATCGACAACAC
CAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCCCGTCCCCTGTTTAAAGACCGCAG
GAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGCCGATTTCCTATGCGGGGCCTGTA
TCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAGCAAGCTGCCACTAGGCCTTTTAT
AGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCCCAGACATATGATCCAAATACACC
TGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGGGCCAGAAACCGTGTTGGTGCGAA
TTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAACAATCTCCAGATTTAAGGAAAGA
AGGCACCACAACATCAAAATATGAAGCTGAGGTTAGCAGGACTAATTCTGGCAGTGGCTC
TGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACAGGTTCACAGATGGGTAGTCCTGC
TCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACTGATAGGCAGCGTGCAGTCGCAGA
GGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAGTGGCCAAATGCTCGTGGCAGCTT
TGATAGTACAAATGAGTAAACCTCTGAAGCAGAAGGTTCAGTTAAGTCGTCATTCTAGGG
GAAAAAAAAAGATGAATCACTTGCAGAACCCAACTGGGTCGAATTAGGTACATGGGGCAT
TTTCGCTCCATCTCGGCTCTGCGGTCTATGTGAATAGAGCTTCTCTTTTTCTTTTTTCTG
TCCTGGAGACACCACCGCTGCTTCAGAGCTCTCCTCTCGTCCATACGAATAGCATCACCG
CGATCTCATCGTCGACGCGCCTATTCCTGGCGTCCATTCCTCGTGATTGATCATGCAAAT
GTGCCTTTTATTCATCATGAAGACAGAAACACCGTTTGGCTGGAAATGTAGGTAGAAAGC
AAAAGAGAAAATTTGCTCTGGAGCTATCCATTGGGTATCTCATGTCGATGTTGTTGCATG
ATGAGTGTCAGCGGCTGCACCATTGTTCCTGAGTGTTCTAGCTCTATGTGAAGTGAAGTC
TGCGTACCGAGGGATGTGATGTTCTTTTTTCTTTTCTTTTCTTTTCTTTTTGTCTCAATG
GTTTGTACCTAGGGGGTACGGCATTTTACCTGTGTTTCATACACCTGTCATTTGACAATT
TCATGTCGGAGTTATCTGTTGTTT

CDS

1476 bp

>Os05t0372100-04 Similar to protein kinase family protein.
ATGGGCTGCTTTCCGTGCTTCGGGTCGGGCGGCAAGGGGGAGGCGAAGAAGGGCGGCGGC
GGGCGCAAGGACGGCGGCTCGGCGGATCGCCGCGTCGCCCGGGTCGGATCAGATAAATCA
AAATCACAGGGTGGATTGGACTCTAGGAAGGATGCATTCATCCCAAGGGATGCGAATGGT
CAACCTATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTC
AGACAAGATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAG
AATGGGCAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAG
TTTCTGGTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATT
GGATACTGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCA
CTTGAGGATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGG
ATGAAGATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCT
CCTGTTATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGGTGAGGGATACCATCCA
AAACTATCAGACTTTGGCCTGGCAAAACTTGGCCCTGTTGGTGACAAAACTCATGTTTCG
ACACGTGTTATGGGAACTTATGGCTACTGTGCCCCAGAATATGCGATGACTGGGCAGCTT
ACTGTTAAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACTGGCCGC
AAAGCAATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCCCGTCCC
CTGTTTAAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGCCGATTT
CCTATGCGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAGCAAGCT
GCCACTAGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCCCAGACA
TATGATCCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGGGCCAGA
AACCGTGTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAACAATCT
CCAGATTTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAGGTTAGCAGGACT
AATTCTGGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACAGGTTCA
CAGATGGGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACTGATAGG
CAGCGTGCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAGTGGCCA
AATGCTCGTGGCAGCTTTGATAGTACAAATGAGTAA

Protein

492 aa

>Os05t0372100-04 Similar to protein kinase family protein.
MGCFPCFGSGGKGEAKKGGGGRKDGGSADRRVARVGSDKSKSQGGLDSRKDAFIPRDANG
QPIAAHTFTFRELAAATKNFRQDCLLGEGGFGRVYKGHLENGQAVAVKQLDRNGLQGNRE
FLVEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTR
MKIAAGAAKGLEFLHDKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVS
TRVMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPLGEQNLVAWARP
LFKDRRKFPKMADPLLAGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQT
YDPNTPVQHSRSNASTPRARNRVGANFDQRRLHSPNHQQSPDLRKEGTTTSKYEAEVSRT
NSGSGSGRRAGLDSMDVTGSQMGSPAHAGRKRESSRSTDRQRAVAEAKTWGENSRERKWP
NARGSFDSTNE*

5'UTR

chr05:17922988..17923150 (+ strand) : 163 bp

CDS

chr05:17923151..17923262 (+ strand) : 112 bp

chr05:17926331..17926527 (+ strand) : 197 bp

chr05:17926730..17926919 (+ strand) : 190 bp

chr05:17927556..17927947 (+ strand) : 392 bp

chr05:17929069..17929653 (+ strand) : 585 bp

3'UTR

chr05:17929654..17930258 (+ strand) : 605 bp

FASTA

>Os05t0372100-04 class=Sequence position=chr05:17922988..17930258 (+ strand)
GGATTTCGAG ACCCCCCAGA TCGGGGGGAG AGATCCCCGT GTCGTCTGGT GTGGTGGGTC GGCCTCCGCC CCCCGGCCGC
CGCGCTTCTC TTGATCTTTC TTTCTTTTTT TTGATTTTTT TGCGTTTCCC CTCCGGGAGA GGGGAGGGGA GGAGGGTTCT
TGGATGGGCT GCTTTCCGTG CTTCGGGTCG GGCGGCAAGG GGGAGGCGAA GAAGGGCGGC GGCGGGCGCA AGGACGGCGG
CTCGGCGGAT CGCCGCGTCG CCCGGGTCGG ATCAGGTGCG GTTCTTGTGG TGGGGGTGTG GGGGGAAAGG GTTGGATCTT
GGGGGTGGTT TTGTTTGTAG GAAATGGTAG CTGATGATTT GCTCCGATGT GGTCAGTTCA TGAGATTTTG GTGTGATTCG
GATCAATGGG CGATTCGAAC TTTGTGCTAA CACGTATTCG ATTTTAGCGA ATGGGTTGGA GACAATCTCG AGGTTTCGGC
GCGGATGGTG GTGTGGTGGT ATTTGGGAGA TTTTCCTTTT GTTTGTGTTA GGCTATTTTG ATGGTATGAG TGCTTGATGT
TAGTATGCGT TACTTATCTA TTTGTAGTTT ATCTGTGATG TTTTGGATCG GTAAGCTAGG TCATCCTTTT TGGTTTATCC
TATAACTGAT AGAAGCCAGC GGCTTTAGTG ATATTTTCGT GGATGGATAG GAGGTTGTGG ATGGATAGGA GGTTGCAGTA
TGACTCTTGC AGTATTGGAT TCAGGGGGAC AAGGAAATTA ATGTTTCACT TCTTGTTTAT ACTGATAAAT GATGTGGAAG
TACTTGCAAG ACTGCTATAG ATGTATATGA AGAAATGGAC GAGTCAGGGA GACTTAGCTT CCCCCCAGGA AATATCACCT
GCAATTTTAG CAATAATCGG TAACAATGTG GTTAACCTTG TTAGTAAAGC TGACCTTTGA AAGCATTCTA TCTGTTTGAC
TTATTCTCTG GGCTACAATG ACAAACCTAT GGACAACACA TGCTAGTGTT GGTACGTATG GTAGAAGACC CAGATGCAAC
ATCAAACAAG TGCCAAAGAA GCGTCATTTT GTACTTTTAT TTATTTCCAT ACAACATGGT ACATTCACCA CAAAATTTTA
ATCCTGGTTT GTGATGACCA AAATGGCCAA TGTGTTTTAG AATGATTAGG CAGGTTATCT CAGTTCTTCC ACTGGATATG
TTTTTAATAT GCACAACACA TCTGTAAATG GACTGGAAAA TTATGTGATT TTCATGAAAG ATCTTCTATA TGACATTCAT
CAAAACGGAA ATGCATATTT CAATTTCTCT AATATAATTC TCTGTCTGGA TTTTTGTCCT ATGCTCCAAC TCCAACATGC
ATGCTGACAA AAGTGAAACC TTTCCGACTT TGTCCTGACT TAAACATATT TTTTATTCAC CCCCCTCAAT CGATAAGACA
ATAAATCAAT ATAACTTGTA TAATGATGAT ATTGAGCGCA GTTTAGCTGG CCATGGATTC CGTTTGTGTT TCAAGATGAG
GCATTGATTT TGTAGGGATT TTTCATCAGA CTGTAAATGG TCTAATCATC AATAACTAAA ATTGTACCTG CTTTTCACAT
TTGTTATTAT AAAAGCTCAA ACTATCGTAA TATGAGGAGG CACCACATTT TCTCCGAGTG GTCAAAATGT ACAACTCTAA
TCAGAGGGAG AAGAAATGAG TCAGCATTTG GTGTGCCCAT AAATaagaga aaattcctta tataccattg gatgttaccc
tattcctcta ttgccattca aaaattgACG TTTAATTATT TTTCACATTC TCATTTCTTG TTCCTCTTTC TTCTCCTTTC
CTCTCTTCCT CTCTCTCCTC ACCTGCTGTT TCCTTTTTAT TTCTTCCTTC CTAGCCTGTT CTGTCTTCGA GGATGTTACC
CTATTCCTCC ATGGCCTTGT TCCTCTTTCT TCTCCTTTCC TCTCTTCCTC TCTCTCCTCA CCTGCTGTTT CCTTTTTATT
TCTTCCTTCC TAGCCTGTTC TGTCTTCAAG GTCTGCTGTA CTGAGCACCG TGGATGATTA CATCAAGCCA GAATACCATG
AAGTTGGGGC CCATTGTCAA TAGAGACTGA GGTCAAAGCC ATAATGTTGG GGGACAAATA CAAAGAATGG CTGAAATTGA
AGCCATGACG ACGGGAAGAG CACATTGGCA GCAGTGTGAG CTTGGCAGTG CACAAATTGA GGCACGATGG CACATGAAGT
TAAAGCTCCT CGTCCAAGGA TTAGGCTGTC TGCGCTTGAA ATCAGAACAC ACTGGCAACA AAATCTAAGT TCCTTCCTCT
CGTTCTAAAC CCAAGGTCCA TGGTGGCTAA CTGGCCATGA CCTTGAAGGC AGTGGTTGTG TTTGGGAATG GTGTGGATGT
GTCTAGCAGC AGTAGAAAGA CATTAAGTCC GTCCACTGAC AACAATGCTT GGCTGCAGGG GGCTGCATCC ATGGCTGCCG
AAATCAAAAC TTGAGGGTGG CAAAGCTTTT TTGGCTGTGG GGACGAGCTC AGTGGCAGCT GAATTTGTAA TCAATGGTAC
ATCGTTGGGG CTGGGAGAGG TGAGGGAGGC AACTAAATTA CATGGGTGAT TATGTGATTG GGATAGGAGA GGGAAGTCCA
GCAGTTGAGC CGCTTAGAGT ACCTTGTGGA CCATGGTAGC GTGCCATCTG GCATGGTGGG TGAATAAGAG AGAGGAGTAT
TTAGTGCAGC TGGCTGTAGG TTGATATTAG TGCTAGTAGA GTAGGGTATG GTCGTTTTAT TTTTTATTGG TGGCACATTG
GTAATGTTTT GATACTAAAA TGTACTAATG TTTCTCTTCC GCGTATTCGA GAAAAATGAA GAAGAGAGGA GAGCAGAAAG
AGATTGGATG AAGATGATAA GTGGCCGTGT AAGGGCAAGA ATAGGATTTT GCCAAGAAAA AAAAAACCTG ACCACTAACA
ATGCGTCGTC CTACCAGAGT AATAAATGGA CTAGGGCAAG AAAGGGTTAT TAAATATGGG TCGGTGGAAA ATAAGTGAAC
ATCAAATTTT AGATGGTAAA TAGGGGATTT AAGTAACACT CAATGGTACA TAAGGAATTT TCTCAGTAAA AAAGGGAAGT
TTACTAAATA GATATTATTA CTGTTATATT TGATTTGTTT AATAACAAAC ATAACCATAT TCTCAATTTA GGTATTAGAG
CATTTTAAGC AATTTAACTG CACAATCATG TGGTATCTAT GACTTGTTTT TACTATTTTA CTATTTATTC TTTAGGAGTA
GTTCACCTTT TTTTGTTACA TTGATGATTC AGGTGGCCCC TAACACTAGA TCATTTTCTC TAGATAAATC AAAATCACAG
GGTGGATTGG ACTCTAGGAA GGATGCATTC ATCCCAAGGG ATGCGAATGG TCAACCTATT GCTGCACACA CTTTCACTTT
TCGTGAACTT GCTGCTGCCA CTAAGAACTT CAGACAAGAT TGTCTATTGG GGGAGGGAGG TTTTGGCCGC GTATATAAAG
GACACTTGGA GAATGGGCAG GTTTGTGTTC TGAAATATGT TTTTCGTGGT TGGGGATTTT TTGAATTCTC TATGGTTAGC
TACTGTGCAC TTTTGGTAAT TTGCGTACTA AAACACCACA TTATGGTTAC TGCATTTCTT TTAACCCCCT ATGTGATCTG
TGGAGCATTA GAGGAGACAT GTTTCCTTAA AGTCTTGATC GATGAGCTTA CCAAATATGC AGGCTGTTGC AGTGAAGCAA
CTTGATCGCA ATGGACTTCA AGGAAATAGA GAGTTTCTGG TTGAAGTCCT TATGCTCAGT CTATTGCACC ATGATAACCT
GGTTAACCTA ATTGGATACT GTGCTGATGG GGATCAACGT CTCCTTGTAT ATGAGTTTAT GCCATTGGGA TCACTTGAGG
ATCATTTGCA TGGTAAATTT GCTACTCTAC TACACTCATG AACTCCTATT GTATTTGTAT GCCTATGTCC TGTATATTCA
AAGACACATG TGGCATTATA CATGCAGTAT CTGTCAACTC AGCTTGCAAG TACCTACATG TGTTTATTCT ATCGTTGTGA
GCTCGTTATA ACTCACACTT CCAACAGTAT AAAGTTTCTT CCAGAAAAAG GAAAAAAAAC AACAGTTTTG TGGGTTATCC
TGTATTAACT CACAATTAAT AAATACTAGT TAAAATAATT TGCGTCGTGA AAGTGGTTTA CCAAACAGAA ACCTTACATT
GTTGTTACTT CAACTTTATT GTCTCCCACA TATCCTGTCT CAAGTTTATA TATCTAGAAT ACCCTATGAT GTAATTATGC
TCAGATACTT GTTCCATTGC TAAATCATGA AAACAAAACA TTGTGTCTAT AATCTGGACT TGATTTACTT AGCATTATGG
TTTTTCGAAA CCAACAGACT CTTATGTTTC CATAAAAGTT GGTAATATGC AACAACGATG TCTGCATCAG ACTCTTAAGC
GCATTGTTTG TTCATAAGAC GTATTTAGTT TGTTTAAATT AATTTGCATG ATTCATAAAT GGCAACGTTT TGTACTTTTG
TGTGTTAGAT ATTCCACCTG ACAAGGAACC TCTCGACTGG AATACACGGA TGAAGATTGC TGCTGGTGCA GCCAAGGGCT
TGGAATTCTT GCATGACAAG GCAAATCCTC CTGTTATTTA CAGGGATTTC AAGTCATCGA ACATTCTTCT TGGTGAGGGA
TACCATCCAA AACTATCAGA CTTTGGCCTG GCAAAACTTG GCCCTGTTGG TGACAAAACT CATGTTTCGA CACGTGTTAT
GGGAACTTAT GGCTACTGTG CCCCAGAATA TGCGATGACT GGGCAGCTTA CTGTTAAATC TGATGTGTAT AGTTTTGGTG
TTGTGTTCCT TGAACTGATT ACTGGCCGCA AAGCAATCGA CAACACCAAA CCACTTGGAG AGCAGAACCT AGTGGCATGG
GTATGTTCAT CTATTGTCTA AATTTTGTCA TAAGCTTGAT GGTTGCCTAT CGATATATCG TAGCAAATTC ATTTATTTTA
CAATTTCTTG GATGAAGCAT AGGTACTAAA ACATTGTAGT TAAGGAAAAA ATGAACTAAA AGATTTAAAA GTATAACTAG
GATGGGAGTA AACTGTTTTT CCTAGCTTGG AAAATGAAAT AATCCACTAG CCAAAAAGCT AATGTCTCAA AAGACATTTT
TGGAAATTGT GCAAGGTTAG TCTTTTATTT ACTTCTCAGA TCATATAACC TTTTCTAACT GAACCTTGAG ACTAACATTT
ATATCAAATG CCTCATTTGT TAATTCATAT GGCATTTCCC TCGTATTTTC TGGAACGCAA TCTTCGAAAG CCTTACACTG
TAGCACATAT AACATGCAAT CTTCGAAAAC TATTTCTATT CAGCTATTGT TATTGCTTAT TCATCCAGAA ACAGTAACTT
TTCATTAGGC AGTTTGACCA GGGTCAGCCC TTCTTGGCCT TGGATTTATT GTCAGTTCCA AACCAATTTT GATTTTTTAA
GAATGATTTT ACATTTTTTT TTACTTTTCT TATTAGCAAT CATGAAAGGA GAAAGCAATT AGAGCGATGA AGAAAACCCC
TAAAATTGAT CATGAAGTCA AAAGTTTAAA TTAAATTCAG CTTAGAATTA TGATCTGGAG CTGAGGAGCT CAGCCAAGCG
GGTAAACCAG CTGGTAAAGT TTGTTGATTT GACTTTATAA TCTAAACCAG CTGAGCATAC TTGTATAATT GTCAAGTTTA
CCTCAATATC GGATTCCACC TTGGTTCTGA AATCCTCTTA TAATACAAGA ACGGTGTCTC TTATCAAGTG AGCGTAAAGT
AGTTTTTTTT TGGGGGGGAA AGTAATTATT TTATTTTGAT TGTTAACACC AGTGGAATTA GGTTATTTAT TATTGACCAT
TGACACTAGT TCTTGTGATA TCTTGATCAC TCCTTTATCT ATACTAATTT ATTACCTGAC AATATATTTT CTTGCAGTTG
CAGATTTAAA TAAGCTTTAC TTTCGATAAA TATTCAGATA ACACAATTTT GGATATCTGA TACCATTGAT CTTATTTGCA
GGCCCGTCCC CTGTTTAAAG ACCGCAGGAA ATTTCCTAAA ATGGCTGATC CATTACTTGC GGGCCGATTT CCTATGCGGG
GCCTGTATCA GGCTTTAGCA GTTGCTGCAA TGTGTTTGCA GGAGCAAGCT GCCACTAGGC CTTTTATAGG AGATGTGGTC
ACTGCTCTTT CATATCTTGC TTCCCAGACA TATGATCCAA ATACACCTGT TCAGCACAGT CGGAGCAATG CATCTACCCC
TAGGGCCAGA AACCGTGTTG GTGCGAATTT TGACCAGCGT CGTCTTCACT CACCAAATCA CCAACAATCT CCAGATTTAA
GGAAAGAAGG CACCACAACA TCAAAATATG AAGCTGAGGT TAGCAGGACT AATTCTGGCA GTGGCTCTGG TCGACGAGCT
GGCTTGGACA GCATGGATGT GACAGGTTCA CAGATGGGTA GTCCTGCTCA CGCAGGAAGG AAGAGGGAAT CATCGCGGAG
TACTGATAGG CAGCGTGCAG TCGCAGAGGC CAAAACATGG GGGGAGAATT CAAGAGAAAG AAAGTGGCCA AATGCTCGTG
GCAGCTTTGA TAGTACAAAT GAGTAAACCT CTGAAGCAGA AGGTTCAGTT AAGTCGTCAT TCTAGGGGAA AAAAAAAGAT
GAATCACTTG CAGAACCCAA CTGGGTCGAA TTAGGTACAT GGGGCATTTT CGCTCCATCT CGGCTCTGCG GTCTATGTGA
ATAGAGCTTC TCTTTTTCTT TTTTCTGTCC TGGAGACACC ACCGCTGCTT CAGAGCTCTC CTCTCGTCCA TACGAATAGC
ATCACCGCGA TCTCATCGTC GACGCGCCTA TTCCTGGCGT CCATTCCTCG TGATTGATCA TGCAAATGTG CCTTTTATTC
ATCATGAAGA CAGAAACACC GTTTGGCTGG AAATGTAGGT AGAAAGCAAA AGAGAAAATT TGCTCTGGAG CTATCCATTG
GGTATCTCAT GTCGATGTTG TTGCATGATG AGTGTCAGCG GCTGCACCAT TGTTCCTGAG TGTTCTAGCT CTATGTGAAG
TGAAGTCTGC GTACCGAGGG ATGTGATGTT CTTTTTTCTT TTCTTTTCTT TTCTTTTTGT CTCAATGGTT TGTACCTAGG
GGGTACGGCA TTTTACCTGT GTTTCATACA CCTGTCATTT GACAATTTCA TGTCGGAGTT ATCTGTTGTT T

Locus: Os05g0372100

Loading...

Locus: Os05g0372100

Loading...