Os05t0372100-05

Locus

Os05g0372100

Description

Similar to protein kinase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RLCK185

CGSNL Gene Name

RECEPTOR-LIKE CYTOPLASMIC KINASE 185

Oryzabase Gene Symbol Synonym(s)

OsRLCK185

Oryzabase Gene Name Synonym(s)

Receptor-like Cytoplasmic Kinase 185

Transcript Evidence

AK111926 (DDBJ, Best hit)

Protein Evidence

XP_002871824.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

001-014-C09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0372100-05)

RiceXPro (AK111926)

Others

Oryzabase (12338)

KEGG (Os05t0372100-05)

Transcript

1901 bp

>Os05t0372100-05 Similar to protein kinase family protein.
ATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTCAGACAA
GATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAGAATGGG
CAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAGTTTCTG
GTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATTGGATAC
TGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCACTTGAG
GATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGGATGAAG
ATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCTCCTGTT
ATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGGTGAGGGATACCATCCAAAACTA
TCAGACTTTGGCCTGGCAAAACTTGGCCCTGTTGGTGACAAAACTCATGTTTCGACACGT
GTTATGGGAACTTATGGCTACTGTGCCCCAGAATATGCGATGACTGGGCAGCTTACTGTT
AAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACTGGCCGCAAAGCA
ATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCCCGTCCCCTGTTT
AAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGCCGATTTCCTATG
CGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAGCAAGCTGCCACT
AGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCCCAGACATATGAT
CCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGGGCCAGAAACCGT
GTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAACAATCTCCAGAT
TTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAGGTTAGCAGGACTAATTCT
GGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACAGGTTCACAGATG
GGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACTGATAGGCAGCGT
GCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAGTGGCCAAATGCT
CGTGGCAGCTTTGATAGTACAAATGAGTAAACCTCTGAAGCAGAAGGTTCAGTTAAGTCG
TCATTCTAGGGGAAAAAAAAAGATGAATCACTTGCAGAACCCAACTGGGTCGAATTAGGT
ACATGGGGCATTTTCGCTCCATCTCGGCTCTGCGGTCTATGTGAATAGAGCTTCTCTTTT
TCTTTTTTCTGTCCTGGAGACACCACCGCTGCTTCAGAGCTCTCCTCTCGTCCATACGAA
TAGCATCACCGCGATCTCATCGTCGACGCGCCTATTCCTGGCGTCCATTCCTCGTGATTG
ATCATGCAAATGTGCCTTTTATTCATCATGAAGACAGAAACACCGTTTGGCTGGAAATGT
AGGTAGAAAGCAAAAGAGAAAATTTGCTCTGGAGCTATCCATTGGGTATCTCATGTCGAT
GTTGTTGCATGATGAGTGTCAGCGGCTGCACCATTGTTCCTGAGTGTTCTAGCTCTATGT
GAAGTGAAGTCTGCGTACCGAGGGATGTGATGTTCTTTTTTCTTTTCTTTTCTTTTCTTT
TTGTCTCAATGGTTTGTACCTAGGGGGTACGGCATTTTACCTGTGTTTCATACACCTGTC
ATTTGACAATTTCATGTCGGAGTTATCTGTTGTTTTATCTC

CDS

1290 bp

>Os05t0372100-05 Similar to protein kinase family protein.
ATTGCTGCACACACTTTCACTTTTCGTGAACTTGCTGCTGCCACTAAGAACTTCAGACAA
GATTGTCTATTGGGGGAGGGAGGTTTTGGCCGCGTATATAAAGGACACTTGGAGAATGGG
CAGGCTGTTGCAGTGAAGCAACTTGATCGCAATGGACTTCAAGGAAATAGAGAGTTTCTG
GTTGAAGTCCTTATGCTCAGTCTATTGCACCATGATAACCTGGTTAACCTAATTGGATAC
TGTGCTGATGGGGATCAACGTCTCCTTGTATATGAGTTTATGCCATTGGGATCACTTGAG
GATCATTTGCATGATATTCCACCTGACAAGGAACCTCTCGACTGGAATACACGGATGAAG
ATTGCTGCTGGTGCAGCCAAGGGCTTGGAATTCTTGCATGACAAGGCAAATCCTCCTGTT
ATTTACAGGGATTTCAAGTCATCGAACATTCTTCTTGGTGAGGGATACCATCCAAAACTA
TCAGACTTTGGCCTGGCAAAACTTGGCCCTGTTGGTGACAAAACTCATGTTTCGACACGT
GTTATGGGAACTTATGGCTACTGTGCCCCAGAATATGCGATGACTGGGCAGCTTACTGTT
AAATCTGATGTGTATAGTTTTGGTGTTGTGTTCCTTGAACTGATTACTGGCCGCAAAGCA
ATCGACAACACCAAACCACTTGGAGAGCAGAACCTAGTGGCATGGGCCCGTCCCCTGTTT
AAAGACCGCAGGAAATTTCCTAAAATGGCTGATCCATTACTTGCGGGCCGATTTCCTATG
CGGGGCCTGTATCAGGCTTTAGCAGTTGCTGCAATGTGTTTGCAGGAGCAAGCTGCCACT
AGGCCTTTTATAGGAGATGTGGTCACTGCTCTTTCATATCTTGCTTCCCAGACATATGAT
CCAAATACACCTGTTCAGCACAGTCGGAGCAATGCATCTACCCCTAGGGCCAGAAACCGT
GTTGGTGCGAATTTTGACCAGCGTCGTCTTCACTCACCAAATCACCAACAATCTCCAGAT
TTAAGGAAAGAAGGCACCACAACATCAAAATATGAAGCTGAGGTTAGCAGGACTAATTCT
GGCAGTGGCTCTGGTCGACGAGCTGGCTTGGACAGCATGGATGTGACAGGTTCACAGATG
GGTAGTCCTGCTCACGCAGGAAGGAAGAGGGAATCATCGCGGAGTACTGATAGGCAGCGT
GCAGTCGCAGAGGCCAAAACATGGGGGGAGAATTCAAGAGAAAGAAAGTGGCCAAATGCT
CGTGGCAGCTTTGATAGTACAAATGAGTAA

Protein

430 aa

>Os05t0372100-05 Similar to protein kinase family protein.
IAAHTFTFRELAAATKNFRQDCLLGEGGFGRVYKGHLENGQAVAVKQLDRNGLQGNREFL
VEVLMLSLLHHDNLVNLIGYCADGDQRLLVYEFMPLGSLEDHLHDIPPDKEPLDWNTRMK
IAAGAAKGLEFLHDKANPPVIYRDFKSSNILLGEGYHPKLSDFGLAKLGPVGDKTHVSTR
VMGTYGYCAPEYAMTGQLTVKSDVYSFGVVFLELITGRKAIDNTKPLGEQNLVAWARPLF
KDRRKFPKMADPLLAGRFPMRGLYQALAVAAMCLQEQAATRPFIGDVVTALSYLASQTYD
PNTPVQHSRSNASTPRARNRVGANFDQRRLHSPNHQQSPDLRKEGTTTSKYEAEVSRTNS
GSGSGRRAGLDSMDVTGSQMGSPAHAGRKRESSRSTDRQRAVAEAKTWGENSRERKWPNA
RGSFDSTNE*

CDS

chr05:17926405..17926527 (+ strand) : 123 bp

chr05:17926730..17926919 (+ strand) : 190 bp

chr05:17927556..17927947 (+ strand) : 392 bp

chr05:17929069..17929653 (+ strand) : 585 bp

3'UTR

chr05:17929654..17930264 (+ strand) : 611 bp

FASTA

>Os05t0372100-05 class=Sequence position=chr05:17926405..17930264 (+ strand)
ATTGCTGCAC ACACTTTCAC TTTTCGTGAA CTTGCTGCTG CCACTAAGAA CTTCAGACAA GATTGTCTAT TGGGGGAGGG
AGGTTTTGGC CGCGTATATA AAGGACACTT GGAGAATGGG CAGGTTTGTG TTCTGAAATA TGTTTTTCGT GGTTGGGGAT
TTTTTGAATT CTCTATGGTT AGCTACTGTG CACTTTTGGT AATTTGCGTA CTAAAACACC ACATTATGGT TACTGCATTT
CTTTTAACCC CCTATGTGAT CTGTGGAGCA TTAGAGGAGA CATGTTTCCT TAAAGTCTTG ATCGATGAGC TTACCAAATA
TGCAGGCTGT TGCAGTGAAG CAACTTGATC GCAATGGACT TCAAGGAAAT AGAGAGTTTC TGGTTGAAGT CCTTATGCTC
AGTCTATTGC ACCATGATAA CCTGGTTAAC CTAATTGGAT ACTGTGCTGA TGGGGATCAA CGTCTCCTTG TATATGAGTT
TATGCCATTG GGATCACTTG AGGATCATTT GCATGGTAAA TTTGCTACTC TACTACACTC ATGAACTCCT ATTGTATTTG
TATGCCTATG TCCTGTATAT TCAAAGACAC ATGTGGCATT ATACATGCAG TATCTGTCAA CTCAGCTTGC AAGTACCTAC
ATGTGTTTAT TCTATCGTTG TGAGCTCGTT ATAACTCACA CTTCCAACAG TATAAAGTTT CTTCCAGAAA AAGGAAAAAA
AACAACAGTT TTGTGGGTTA TCCTGTATTA ACTCACAATT AATAAATACT AGTTAAAATA ATTTGCGTCG TGAAAGTGGT
TTACCAAACA GAAACCTTAC ATTGTTGTTA CTTCAACTTT ATTGTCTCCC ACATATCCTG TCTCAAGTTT ATATATCTAG
AATACCCTAT GATGTAATTA TGCTCAGATA CTTGTTCCAT TGCTAAATCA TGAAAACAAA ACATTGTGTC TATAATCTGG
ACTTGATTTA CTTAGCATTA TGGTTTTTCG AAACCAACAG ACTCTTATGT TTCCATAAAA GTTGGTAATA TGCAACAACG
ATGTCTGCAT CAGACTCTTA AGCGCATTGT TTGTTCATAA GACGTATTTA GTTTGTTTAA ATTAATTTGC ATGATTCATA
AATGGCAACG TTTTGTACTT TTGTGTGTTA GATATTCCAC CTGACAAGGA ACCTCTCGAC TGGAATACAC GGATGAAGAT
TGCTGCTGGT GCAGCCAAGG GCTTGGAATT CTTGCATGAC AAGGCAAATC CTCCTGTTAT TTACAGGGAT TTCAAGTCAT
CGAACATTCT TCTTGGTGAG GGATACCATC CAAAACTATC AGACTTTGGC CTGGCAAAAC TTGGCCCTGT TGGTGACAAA
ACTCATGTTT CGACACGTGT TATGGGAACT TATGGCTACT GTGCCCCAGA ATATGCGATG ACTGGGCAGC TTACTGTTAA
ATCTGATGTG TATAGTTTTG GTGTTGTGTT CCTTGAACTG ATTACTGGCC GCAAAGCAAT CGACAACACC AAACCACTTG
GAGAGCAGAA CCTAGTGGCA TGGGTATGTT CATCTATTGT CTAAATTTTG TCATAAGCTT GATGGTTGCC TATCGATATA
TCGTAGCAAA TTCATTTATT TTACAATTTC TTGGATGAAG CATAGGTACT AAAACATTGT AGTTAAGGAA AAAATGAACT
AAAAGATTTA AAAGTATAAC TAGGATGGGA GTAAACTGTT TTTCCTAGCT TGGAAAATGA AATAATCCAC TAGCCAAAAA
GCTAATGTCT CAAAAGACAT TTTTGGAAAT TGTGCAAGGT TAGTCTTTTA TTTACTTCTC AGATCATATA ACCTTTTCTA
ACTGAACCTT GAGACTAACA TTTATATCAA ATGCCTCATT TGTTAATTCA TATGGCATTT CCCTCGTATT TTCTGGAACG
CAATCTTCGA AAGCCTTACA CTGTAGCACA TATAACATGC AATCTTCGAA AACTATTTCT ATTCAGCTAT TGTTATTGCT
TATTCATCCA GAAACAGTAA CTTTTCATTA GGCAGTTTGA CCAGGGTCAG CCCTTCTTGG CCTTGGATTT ATTGTCAGTT
CCAAACCAAT TTTGATTTTT TAAGAATGAT TTTACATTTT TTTTTACTTT TCTTATTAGC AATCATGAAA GGAGAAAGCA
ATTAGAGCGA TGAAGAAAAC CCCTAAAATT GATCATGAAG TCAAAAGTTT AAATTAAATT CAGCTTAGAA TTATGATCTG
GAGCTGAGGA GCTCAGCCAA GCGGGTAAAC CAGCTGGTAA AGTTTGTTGA TTTGACTTTA TAATCTAAAC CAGCTGAGCA
TACTTGTATA ATTGTCAAGT TTACCTCAAT ATCGGATTCC ACCTTGGTTC TGAAATCCTC TTATAATACA AGAACGGTGT
CTCTTATCAA GTGAGCGTAA AGTAGTTTTT TTTTGGGGGG GAAAGTAATT ATTTTATTTT GATTGTTAAC ACCAGTGGAA
TTAGGTTATT TATTATTGAC CATTGACACT AGTTCTTGTG ATATCTTGAT CACTCCTTTA TCTATACTAA TTTATTACCT
GACAATATAT TTTCTTGCAG TTGCAGATTT AAATAAGCTT TACTTTCGAT AAATATTCAG ATAACACAAT TTTGGATATC
TGATACCATT GATCTTATTT GCAGGCCCGT CCCCTGTTTA AAGACCGCAG GAAATTTCCT AAAATGGCTG ATCCATTACT
TGCGGGCCGA TTTCCTATGC GGGGCCTGTA TCAGGCTTTA GCAGTTGCTG CAATGTGTTT GCAGGAGCAA GCTGCCACTA
GGCCTTTTAT AGGAGATGTG GTCACTGCTC TTTCATATCT TGCTTCCCAG ACATATGATC CAAATACACC TGTTCAGCAC
AGTCGGAGCA ATGCATCTAC CCCTAGGGCC AGAAACCGTG TTGGTGCGAA TTTTGACCAG CGTCGTCTTC ACTCACCAAA
TCACCAACAA TCTCCAGATT TAAGGAAAGA AGGCACCACA ACATCAAAAT ATGAAGCTGA GGTTAGCAGG ACTAATTCTG
GCAGTGGCTC TGGTCGACGA GCTGGCTTGG ACAGCATGGA TGTGACAGGT TCACAGATGG GTAGTCCTGC TCACGCAGGA
AGGAAGAGGG AATCATCGCG GAGTACTGAT AGGCAGCGTG CAGTCGCAGA GGCCAAAACA TGGGGGGAGA ATTCAAGAGA
AAGAAAGTGG CCAAATGCTC GTGGCAGCTT TGATAGTACA AATGAGTAAA CCTCTGAAGC AGAAGGTTCA GTTAAGTCGT
CATTCTAGGG GAAAAAAAAA GATGAATCAC TTGCAGAACC CAACTGGGTC GAATTAGGTA CATGGGGCAT TTTCGCTCCA
TCTCGGCTCT GCGGTCTATG TGAATAGAGC TTCTCTTTTT CTTTTTTCTG TCCTGGAGAC ACCACCGCTG CTTCAGAGCT
CTCCTCTCGT CCATACGAAT AGCATCACCG CGATCTCATC GTCGACGCGC CTATTCCTGG CGTCCATTCC TCGTGATTGA
TCATGCAAAT GTGCCTTTTA TTCATCATGA AGACAGAAAC ACCGTTTGGC TGGAAATGTA GGTAGAAAGC AAAAGAGAAA
ATTTGCTCTG GAGCTATCCA TTGGGTATCT CATGTCGATG TTGTTGCATG ATGAGTGTCA GCGGCTGCAC CATTGTTCCT
GAGTGTTCTA GCTCTATGTG AAGTGAAGTC TGCGTACCGA GGGATGTGAT GTTCTTTTTT CTTTTCTTTT CTTTTCTTTT
TGTCTCAATG GTTTGTACCT AGGGGGTACG GCATTTTACC TGTGTTTCAT ACACCTGTCA TTTGACAATT TCATGTCGGA
GTTATCTGTT GTTTTATCTC 

Locus: Os05g0372100

Loading...

Locus: Os05g0372100

Loading...