Os05t0373300-01

Locus

Os05g0373300

Description

Copine protein, Negative regulation of disease resistance, Positive regulation of plant growth and development

RAP-DB Gene Symbol Synonym(s)

OsBON3

RAP-DB Gene Name Synonym(s)

BONZAI 3

CGSNL Gene Symbol

BON3

CGSNL Gene Name

BONZAI 3

Oryzabase Gene Symbol Synonym(s)

OsBON3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK240945

Protein Evidence

A0A0P0WLH0

Literature

PMID: 29356349

Note

Manual Curation

October 19, 2018

Functional domain (InterPro)

C2 domain superfamily (IPR035892)

von Willebrand factor A-like domain superfamily (IPR036465)

C2 domain (IPR000008)

Copine, C2B domain (IPR037768)

Copine (IPR010734)

von Willebrand factor, type A (IPR002035)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J065042M02 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0373300-01)

Others

Oryzabase (22264)

KEGG (Os05t0373300-01)

Transcript

2134 bp

>Os05t0373300-01 Copine protein, Negative regulation of disease resistance, Positive regulation of plant growth and development
GCCTTGATCATAAACAAATTCGATTCGAAATCGCGCATCCAAACTCTGCGACGAACGTTT
TCGCCGCGGCGAGAGAGAAGTCGAGGGAGATGGGCGGGTGCTTGTCCGGCGACGTGCGCG
GCGGCATGGAGGCCGTGGGCGGGAGCGGCGGCCGCGGGGCGGCAGGGACCGGAGGAGGAG
GGGGAGGAGGGGCGGGGCAGGGCGGCGGGGCGAACGAGGCGGTGGACCACTTCTTCAACG
CCGCCGGCCTCCGCGGCCTCTACTCGCCTCTCGAGCTATCCTTTTCAGCATCAAAGTTGC
GGAATATGGATGCTTTTTCCAAGAGTGATCCAATGTTAGTGATCTACATAAGAAAGGATG
CAAGGCTAGAAGAGATTGGCCGTACTGAAGTGATACTGAACTCACTGGAACCCTCGTGGA
TCACAAAGGCTACAATAAGTTACCAATTTGAGATTATACAGCCGCTTGTATTCAAGATAT
ATGACATCGACACAAGGTACCATAACACGCCAGTCAAGACACTGAACTTGGCTCAGCAAG
ATTTTCTTGGAGAAGCATGCTGCAATTTGTCAGAGATTGTCACAAACAATCACAGCCTGA
CACTTAACCTCAGAGATAGTTGTGGACATACCCTTCTAGGAACAGTGACAGTACATGCTG
AAGAAAGTAATTCCTCAAGGATGGCAGTTGAGATGACACTCCATGCCCTAAACTTGGAAA
ACAAAGATGTATTTTCAAAAAGTGATCCTTTCTTGAGAATATCAAGACTGGTGGAAACTG
CTGGTCCCATTCCTATCTGTAAAACTGAAGTGATCAGCAACAATTTAAACCCTGTTTGGA
GGCCCATAATACTAACATCACAACAATTTGGAAGCAAGGATAACCCATTGCTAGTTGAGT
GTTTTGATTTTGATTCAAGTGGTGACCACGAACTTATTGGGACCTTCCAGACAACTATCA
CTCAACTTGAGAATGTATATAATTCAAAGTCTGGAGCAAATTTTTTCAGCCATAAGGGAC
AGAAAAAGTTGAAGGGACAATTGTTTGTGGATAAGTTCCAGGAAAAAGTTCAACATACTT
TCTTGGACTACATTTCCAGTGGTTTTGAGCTAAATTTTATGGTGGCTGTAGATTTCACGG
CTTCAAATGGTGACCCCCGTTCACCTCAGTCTTTGCACTACATTGACCCCTCTGGCAGAC
CGAACTCATACCAGCAGGCAATACTAGGGGTTGGCGAAGTTCTGCAGTTTTATGACAATG
ATAGGCGATTCCCGGCATGGGGTTTTGGAGCGAAGACACCACAGGGCTACATATCCCACT
GTTTTAATCTGAATGCAACTACCAATGATTGCGAGGTCGTCGGAGTTGAAGGCATCATGT
CAGCATACACCTCTACCCTTTACAGTGTCACCCTTGCTGGGCCAACTCTGTTTGGGCCAA
TTATCAACAAAGCTGCCGAGATTGCCAGCCACTCCCTTCAATACGGAAACAACAAATACT
TTGTCCTACTCATCATCACGGATGGAGTTCTCACTGACATTCAAGAAACAAAAGATTCTA
TCGTGAGGGCATCCGATCTGCCATTGTCAATCCTCATCGTGGGCGTTGGAAATGCTGATT
TCAAGCAAATGGAGATCCTGGATGGAGATAACGGCAAGCGGCTGGAGAGCTCGACCGGCA
GGATCGCGACGCGGGACATCGTCCAGTTCGTCCCCATGAGGGATGTCCAAGGCGGGCAGA
TCTCCGTCGTCCAGTCGCTGCTGGAGGAGCTCCCTGGCCAGTTCCTGGCCTACATGCGCA
GCCGGGACATCAAGCCGCGAGCCCCGCTGCAGCACGACAACGCCTCTTCCGCTCCGCCCC
TTTACCCTCCAACCAAGTGAAGTGTGCTGCTCAGCCCGGACAGGATCGCCGTTGGTTAGG
CTTCAATCCGACTCCAAAATCACCAGTCTGGAAAAAAAAAAAACCCCCCAAAATGTACAT
TCTCTCCTGCTCCAAATCCTAGTTGCAGTAGCTTAGACTAGTCAGTTAAGAGGGGATTAT
TAGAGAGTAATTAGCTCGCAGCCTCGCACTACATTTGGTTTGGTGGTGGTGTAATTTGTG
CGGTGTTTATGAGTTGACCGTGGCCAGTTGCGTC

CDS

1791 bp

>Os05t0373300-01 Copine protein, Negative regulation of disease resistance, Positive regulation of plant growth and development
ATGGGCGGGTGCTTGTCCGGCGACGTGCGCGGCGGCATGGAGGCCGTGGGCGGGAGCGGC
GGCCGCGGGGCGGCAGGGACCGGAGGAGGAGGGGGAGGAGGGGCGGGGCAGGGCGGCGGG
GCGAACGAGGCGGTGGACCACTTCTTCAACGCCGCCGGCCTCCGCGGCCTCTACTCGCCT
CTCGAGCTATCCTTTTCAGCATCAAAGTTGCGGAATATGGATGCTTTTTCCAAGAGTGAT
CCAATGTTAGTGATCTACATAAGAAAGGATGCAAGGCTAGAAGAGATTGGCCGTACTGAA
GTGATACTGAACTCACTGGAACCCTCGTGGATCACAAAGGCTACAATAAGTTACCAATTT
GAGATTATACAGCCGCTTGTATTCAAGATATATGACATCGACACAAGGTACCATAACACG
CCAGTCAAGACACTGAACTTGGCTCAGCAAGATTTTCTTGGAGAAGCATGCTGCAATTTG
TCAGAGATTGTCACAAACAATCACAGCCTGACACTTAACCTCAGAGATAGTTGTGGACAT
ACCCTTCTAGGAACAGTGACAGTACATGCTGAAGAAAGTAATTCCTCAAGGATGGCAGTT
GAGATGACACTCCATGCCCTAAACTTGGAAAACAAAGATGTATTTTCAAAAAGTGATCCT
TTCTTGAGAATATCAAGACTGGTGGAAACTGCTGGTCCCATTCCTATCTGTAAAACTGAA
GTGATCAGCAACAATTTAAACCCTGTTTGGAGGCCCATAATACTAACATCACAACAATTT
GGAAGCAAGGATAACCCATTGCTAGTTGAGTGTTTTGATTTTGATTCAAGTGGTGACCAC
GAACTTATTGGGACCTTCCAGACAACTATCACTCAACTTGAGAATGTATATAATTCAAAG
TCTGGAGCAAATTTTTTCAGCCATAAGGGACAGAAAAAGTTGAAGGGACAATTGTTTGTG
GATAAGTTCCAGGAAAAAGTTCAACATACTTTCTTGGACTACATTTCCAGTGGTTTTGAG
CTAAATTTTATGGTGGCTGTAGATTTCACGGCTTCAAATGGTGACCCCCGTTCACCTCAG
TCTTTGCACTACATTGACCCCTCTGGCAGACCGAACTCATACCAGCAGGCAATACTAGGG
GTTGGCGAAGTTCTGCAGTTTTATGACAATGATAGGCGATTCCCGGCATGGGGTTTTGGA
GCGAAGACACCACAGGGCTACATATCCCACTGTTTTAATCTGAATGCAACTACCAATGAT
TGCGAGGTCGTCGGAGTTGAAGGCATCATGTCAGCATACACCTCTACCCTTTACAGTGTC
ACCCTTGCTGGGCCAACTCTGTTTGGGCCAATTATCAACAAAGCTGCCGAGATTGCCAGC
CACTCCCTTCAATACGGAAACAACAAATACTTTGTCCTACTCATCATCACGGATGGAGTT
CTCACTGACATTCAAGAAACAAAAGATTCTATCGTGAGGGCATCCGATCTGCCATTGTCA
ATCCTCATCGTGGGCGTTGGAAATGCTGATTTCAAGCAAATGGAGATCCTGGATGGAGAT
AACGGCAAGCGGCTGGAGAGCTCGACCGGCAGGATCGCGACGCGGGACATCGTCCAGTTC
GTCCCCATGAGGGATGTCCAAGGCGGGCAGATCTCCGTCGTCCAGTCGCTGCTGGAGGAG
CTCCCTGGCCAGTTCCTGGCCTACATGCGCAGCCGGGACATCAAGCCGCGAGCCCCGCTG
CAGCACGACAACGCCTCTTCCGCTCCGCCCCTTTACCCTCCAACCAAGTGA

Protein

597 aa

>Os05t0373300-01 Copine protein, Negative regulation of disease resistance, Positive regulation of plant growth and development
MGGCLSGDVRGGMEAVGGSGGRGAAGTGGGGGGGAGQGGGANEAVDHFFNAAGLRGLYSP
LELSFSASKLRNMDAFSKSDPMLVIYIRKDARLEEIGRTEVILNSLEPSWITKATISYQF
EIIQPLVFKIYDIDTRYHNTPVKTLNLAQQDFLGEACCNLSEIVTNNHSLTLNLRDSCGH
TLLGTVTVHAEESNSSRMAVEMTLHALNLENKDVFSKSDPFLRISRLVETAGPIPICKTE
VISNNLNPVWRPIILTSQQFGSKDNPLLVECFDFDSSGDHELIGTFQTTITQLENVYNSK
SGANFFSHKGQKKLKGQLFVDKFQEKVQHTFLDYISSGFELNFMVAVDFTASNGDPRSPQ
SLHYIDPSGRPNSYQQAILGVGEVLQFYDNDRRFPAWGFGAKTPQGYISHCFNLNATTND
CEVVGVEGIMSAYTSTLYSVTLAGPTLFGPIINKAAEIASHSLQYGNNKYFVLLIITDGV
LTDIQETKDSIVRASDLPLSILIVGVGNADFKQMEILDGDNGKRLESSTGRIATRDIVQF
VPMRDVQGGQISVVQSLLEELPGQFLAYMRSRDIKPRAPLQHDNASSAPPLYPPTK*

5'UTR

chr05:17983282..17983370 (+ strand) : 89 bp

CDS

chr05:17983371..17983556 (+ strand) : 186 bp

chr05:17985129..17985176 (+ strand) : 48 bp

chr05:17985634..17985779 (+ strand) : 146 bp

chr05:17985869..17985917 (+ strand) : 49 bp

chr05:17986513..17986569 (+ strand) : 57 bp

chr05:17986713..17986880 (+ strand) : 168 bp

chr05:17986968..17987100 (+ strand) : 133 bp

chr05:17987201..17987264 (+ strand) : 64 bp

chr05:17987356..17987443 (+ strand) : 88 bp

chr05:17987530..17987641 (+ strand) : 112 bp

chr05:17987725..17987801 (+ strand) : 77 bp

chr05:17987875..17988012 (+ strand) : 138 bp

chr05:17988677..17988841 (+ strand) : 165 bp

chr05:17988920..17989033 (+ strand) : 114 bp

chr05:17989279..17989375 (+ strand) : 97 bp

chr05:17989495..17989643 (+ strand) : 149 bp

3'UTR

chr05:17989644..17989897 (+ strand) : 254 bp

FASTA

>Os05t0373300-01 class=Sequence position=chr05:17983282..17989897 (+ strand)
GCCTTGATCA TAAACAAATT CGATTCGAAA TCGCGCATCC AAACTCTGCG ACGAACGTTT TCGCCGCGGC GAGAGAGAAG
TCGAGGGAGA TGGGCGGGTG CTTGTCCGGC GACGTGCGCG GCGGCATGGA GGCCGTGGGC GGGAGCGGCG GCCGCGGGGC
GGCAGGGACC GGAGGAGGAG GGGGAGGAGG GGCGGGGCAG GGCGGCGGGG CGAACGAGGC GGTGGACCAC TTCTTCAACG
CCGCCGGCCT CCGCGGCCTC TACTCGCCTC TCGAGGTACG TTCCCCTCCC GAAAACCCTA GTTGTTCAGT TCAGTGGGTT
TTTGGGGGGA GGGGGGAATC CCGGTGGTTA CTTGCCGTCG TTCGCGATCG GCTTCGGCGG AGTGGGTTTT TTGGTAGTAG
CTTTTGGTGG TTGTTTTGGT GGGGAGTGGG GACAATGTGC TTCGGTTTCT GGAGAGGTGA CGGGGGACTC GATGTTCAGA
AATTTCTTAC TATTAGCGGA CGGAAATGTG CCTTGTTTGC GTATGAATTA CTACTACGAC TTTGTCCTTT TCGTTTTGAT
TACTCGCGTG TTTTCCTCCG TAACAACATT GATGTGCCAA TTTGGAGGGT TTTTTTTCCT CCGTAACAAC ATTGTTTGAA
GTCTGAAGGA ATTTTTTTTT TTTGAAAAAA ATGCCGATGC TCCGGTCTGA ACCGGGTTTC ATGTGTGCGT GTTTTCGGTA
ACTACAAATC CTAGTATCCT ACTATCAAAA AAAAATTCTA AACCGATTTT ACCATTTATC CATTACTTAT TTGAATGTGG
TTGGACTTAA TTTGGAAAAT GTGCCCCCAT CAGAACTGTT TCTCGTTGAA AAATTAGGAC TAAGCCATGC GTCAATGTGC
GTTTCTCCTT GATGTTAGAG TTCTGCCTTT TTTAGCCCAA ACTCCATGCA TGCATCCATT TTTTTTATTT TCTTAATTTT
TATTTCACCG TAAATTCAGA AATTAGAACT TCCGGTGCTT GTATGTTCAG TTATTCTGTA TATTGTTCCT CAAATGATGA
TCGGTTTGTT TTTCAGCTGT AAAGTCTCCA AAAAAAACTA ATCAATTTTG TTTTGATAGA GAATTGAATA GTGGGTGCGT
TTCTGCAAAT GGATTAGGAC AGGCAAAATA TGTTATAGGT TGGAGTGGGT GGGAGATATC AATCTCTTTT TCAAATATGC
TAGAGTCTGA CATATAAGAC GTGTGCAGGT GTTGATCAGC ACTAACTTGG CCTGATAACT TGATCCCTAT TTGTGTGTGG
TGTCTCTCTG AGAATAAACT TTATGTCGTA CACATTACCT AAAACATTTA GTTAAAATTT TGGTCTTCAT AAGATTTATT
CAACACCGTC TAAAAATAAA ATATAGTTAT AATATTATAA TCTGTCTTTT ATTCTGAAAA ATATATGCAA GGAAATAAGG
AATGGAGATA TGCCTATTTG AAGAGTTGTA GGTTCACACC TTTTCTCTTT ATAAATTGCC ACTCCACTCA TGCATTTTCC
CCTTACAATT TTAGGCTCAT ATCCTTGGTT GCATGTGCAT AATGTGCTCG CTAGATAGAA CACCTGTAAC AGTTTATTAG
GAGCGTTTGT ATGTTTTGGA TTGTCTTGTA GTGATCTTGA TGTGTGAAAA CTGAAAAGGA CATGCATGGG AGTCATGGAG
AGTTCGGTAT TGTATGAATT TGAACTTTGA AGTCCCATCT GTATGTGGCA CTGTTGCATC AATTCTACAT TTGTCATGCT
GAGTTGCTAA CTAGCTCTGA ACCAGTGGGT CGTGAACGTC ATATGATCTC CAGCACTGAC TTATTTCTAT CTTCCTTACT
ATTGCAGCTA TCCTTTTCAG CATCAAAGTT GCGGAATATG GATGCTTTTT CCAAGGTACA AATCACCATT ACTTTGTAAT
GTTACGATCT GAGTTGTTAA TTAACTTAGT TTTTAAAATA AAACGAGTTT CTAGGTACTT CTAAGAGTGA TGTTGTAAAA
GAGCAACAGT TCTAGTCGGA AGTAGGAAGT AAATATTATA AGTTTAAGTA AATAGGAAAC GATCTTTACT GTCAAATTTT
GAACCAAGTT CGACATGTTT TATTCTCACA TATGTATAAC AGATGTCAAT ACTTATCCTC AAATATACTA GTTAAAACAT
GCAACAAGCC AACAACCAAT ACATCTGTTG ATTTGCACCA TCTATACAAA CATGGTAAAC ATTTTATTCA TTGTCTGTCA
TTGCATTTAC CATAACAACA AAAAGATATG TTCCCTAATT CTGATTGGTT ATTTTCCTTG CATATGTGAA TGTATTCCCC
GAATTTATCC AGTGTCTGAT TACATACTTT AGAGTGATCC AATGTTAGTG ATCTACATAA GAAAGGATGC AAGGCTAGAA
GAGATTGGCC GTACTGAAGT GATACTGAAC TCACTGGAAC CCTCGTGGAT CACAAAGGCT ACAATAAGTT ACCAATTTGA
GATTATACAG CCGCTTGTGT AAGTTTATAA CATATAAATG TAGGAATCAC TTGTAGACAT ATCCTACTTA CCAATTATCA
ATACACTTTT GTTTCCATTT ATGACAGATT CAAGATATAT GACATCGACA CAAGGTACCA TAACACGCCA GTCAAGGTAT
ATTTTGTTCC TTCCGTTCAT ATTTTTCCCT CTTTGAACTT TTCTTTCTCA TGTGCCCATA TTCAATTTGG ATATATTCAA
TCACCTATAA ATATGATCTT GAAATCAATC CATGGTTTTT CATTTATCGC ACCATTTTTC TTTATTATCA TATGGCTATA
TTTGATGGTG TGCATCTTTT AGTCCTTTCC TATTTGTGGA TACTGATGCG TATTTTGGGG GCCTTGAGCT TCTCATGAAA
ATTCTTCCAA CACGCATCAC ATTACATAAT TAAACAAAAA TGGTGCATGT ATACATTTCA TATGTGTTGA AACTAGCTGG
GTGATGATTT GACTGAAGAA TGGCCTCAAT TGTTAATATT TTCTCAGAAA ACCAGCTGGT GACTTGGCTG TAGAATTGTC
TCATCTCATT TAGGCTCCTC TACAGTTTTA CCTTGGTCAC CTAAATATGG TATTTGGGAA ATAAAGTGCA TTACTAAGAG
AATATATAGT AACATTGATG AACAATTGAT TTAACCCATT CCAATTCTGT GCCATTCCTA GCTTGTAAAG TTACTACTAC
TTCTGAATCA TGTATTCGTT GTTTTATGCA GACACTGAAC TTGGCTCAGC AAGATTTTCT TGGAGAAGCA TGCTGCAATT
TGTCAGAGGT ATGATTCCAG TTACAGGATC CTTTGCAAAT AATATGAATT AGATAGTTCC AGTTGCAGTA TACAAGGCAT
CTGAGCACAT GCATAGGGGC AAAGAAACAA GATCGTCTTC TTTTAATATA TATATTTTGT TCTTCGTACA GATTGTCACA
AACAATCACA GCCTGACACT TAACCTCAGA GATAGTTGTG GACATACCCT TCTAGGAACA GTGACAGTAC ATGCTGAAGA
AAGTAATTCC TCAAGGATGG CAGTTGAGAT GACACTCCAT GCCCTAAACT TGGAAAACAA AGATGTATTT TCAAAAAGTG
TATGATACTA CTTCCTCTGC TAGTAAGGTA TGCTACTAGT TAGCAAATTA GTAACACTCG ATTTACATTT GATATTATTC
ACACAGGATC CTTTCTTGAG AATATCAAGA CTGGTGGAAA CTGCTGGTCC CATTCCTATC TGTAAAACTG AAGTGATCAG
CAACAATTTA AACCCTGTTT GGAGGCCCAT AATACTAACA TCACAACAAT TTGGAAGCAA GGCAAGTTCA ATTCTCTGAC
TTTTGGATAT TTGTATTAGT ATTGCATTGC TTGTATAGTC CGAGGTTGGT CTGATGTTTT CTCTGTTTTA AATTATTTCA
GGATAACCCA TTGCTAGTTG AGTGTTTTGA TTTTGATTCA AGTGGTGACC ACGAACTTAT TGGGTATGCA CAAGGACTAA
AGAATCATTT TGCCATCTTT TGCTCTTGTT GCTGAGTTTA ATTATATATA TATCCTTGCT TGTCTTACAA ATAGGACCTT
CCAGACAACT ATCACTCAAC TTGAGAATGT ATATAATTCA AAGTCTGGAG CAAATTTTTT CAGCCATAAG GGACAGAAAA
AGGTTAAGAA TTTCTTATTT TATGTTATCT ACTACACAAA AAGGTAACAC AAAATCTAAT ATTTCTCAAT ATATCTGATC
TGTTTCAGTT GAAGGGACAA TTGTTTGTGG ATAAGTTCCA GGAAAAAGTT CAACATACTT TCTTGGACTA CATTTCCAGT
GGTTTTGAGC TAAATTTTAT GGTGGCTGTA GATTTCACGG GTTAGCGCCA TGTTTCAGCT TAAATATATA GCACTGTCAA
TCTCATATAT ATTTACAAAA GTGCAACCCT GGTGTGTTTT CAGCTTCAAA TGGTGACCCC CGTTCACCTC AGTCTTTGCA
CTACATTGAC CCCTCTGGCA GACCGAACTC ATACCAGCAG GTCAGGGCTT GTTTGATCAA GCTTATTCTC GAAATGAAAG
AAAGCCTGCA AACTGAACTC TTTAATGTAT CAGGCAATAC TAGGGGTTGG CGAAGTTCTG CAGTTTTATG ACAATGATAG
GCGATTCCCG GCATGGGGTT TTGGAGCGAA GACACCACAG GGCTACATAT CCCACTGTTT TAATCTGAAT GCAACTACCA
ATGATTGCGA GGTGAGGTTC ATGGTTGATG AGTTATTTTT TTACACGTTA GCGCTTTGCC CTCCCCCTTT CCTACAATAT
GACATAAGAC ATTCGTTACC ATTGAACCTC TTAGATTCAT GCTTGGTTTG TTTCACTATT TTCCAATAGT AGTCTCTAGT
AAAGCCTCTC ATGCAACAAG TGCTTTTAAG CCATCTTTTG TTCCACTAAA AATCCCTCCA GCCTTTGTAA TTTCTTTAAC
TCATTCTTGT GTGTGGATAT TGCTGATTCA TAATTTTAGG AGCTAGAAGG ACTTGGGAAT GTTAAAAATT GGCATGGCTT
TTCTTATAAC ATTCACAATT AGTTAATTGC TATTCACTGC TACATATGTT TTTACTATTA ATATTTGTGT ATTACTGTAG
ATGGAATGTA CCTTTTGTAT TCAATTTCAT CACTCTTGTA ATAACTATAC TATGTTACCT AATGCATGGC TCTGGTACTG
CCAAATCATG TGTGGTGTTG TTCCTGAAAT CCTTCTGAAC TTTGCCAAAA TAATGAGCAA CATGACTACT AATGCCAATT
GTATTTCTTT TTTTTTTGCA AGTCATTTGT ATTTAATGGT TGATCCTATG TATTTTCTGT TTCTACAATT TATATCATGT
TAATTTATGT TATGAATTTT CAATTACCAT TACAGGTCGT CGGAGTTGAA GGCATCATGT CAGCATACAC CTCTACCCTT
TACAGTGTCA CCCTTGCTGG GCCAACTCTG TTTGGGCCAA TTATCAACAA AGCTGCCGAG ATTGCCAGCC ACTCCCTTCA
ATACGGAAAC AACAAATACT TTGTCCTACT CATCATCACG GTACGCGACC AGATTTCTGA ACATTTTGAG TTTTGACGTC
TATCAAGTCT GTATCACTCA CCTGAACATT TTTTGCAGGA TGGAGTTCTC ACTGACATTC AAGAAACAAA AGATTCTATC
GTGAGGGCAT CCGATCTGCC ATTGTCAATC CTCATCGTGG GCGTTGGAAA TGCTGATTTC AAGCAAATGG AGGTAAAGGC
ATTTACTTCA AAGATAGTAA ATGAAAAAAT AGGCGTATGA TTTAATACCT CATCCAATCA CAGCGTTTCC TTATTTGAAA
GCTTAGCTTA GCTGTTACGA GGGTAGCTCT AGTCCTGCAC TTTGTCGAAC TAATGCAGTA CTTTACTACC TTTTTTCTGA
ATTCTGATTG CATCTAGACA TACATTCCCT TTCATCCTTC ATGCTGATTT TAAATCGACC AATCCCTCTT TTTGCAGATC
CTGGATGGAG ATAACGGCAA GCGGCTGGAG AGCTCGACCG GCAGGATCGC GACGCGGGAC ATCGTCCAGT TCGTCCCCAT
GAGGGATGTC CAAGGTCAGC CACTGACTCA CATATGTTAC CACAGATCAC ACACACAGTG ACAGTGCCCC CTGTAAAATC
TCGTCGCTGA CATTCCATCA AACCCCACAT CTTGGACCGT CGGTTGGGTG CAGGCGGGCA GATCTCCGTC GTCCAGTCGC
TGCTGGAGGA GCTCCCTGGC CAGTTCCTGG CCTACATGCG CAGCCGGGAC ATCAAGCCGC GAGCCCCGCT GCAGCACGAC
AACGCCTCTT CCGCTCCGCC CCTTTACCCT CCAACCAAGT GAAGTGTGCT GCTCAGCCCG GACAGGATCG CCGTTGGTTA
GGCTTCAATC CGACTCCAAA ATCACCAGTC TGGAAAAAAA AAAAACCCCC CAAAATGTAC ATTCTCTCCT GCTCCAAATC
CTAGTTGCAG TAGCTTAGAC TAGTCAGTTA AGAGGGGATT ATTAGAGAGT AATTAGCTCG CAGCCTCGCA CTACATTTGG
TTTGGTGGTG GTGTAATTTG TGCGGTGTTT ATGAGTTGAC CGTGGCCAGT TGCGTC

Locus: Os05g0373300

Loading...

Locus: Os05g0373300

Loading...