Os05t0374200-01

Locus

Os05g0374200

Description

Cytokinin oxidase, Regulation of cytokinin signaling pathway, "Regulation of tillering, plant height, and panicle size"

RAP-DB Gene Symbol Synonym(s)

OsCKX9

RAP-DB Gene Name Synonym(s)

CYTOKININ OXIDASE/DEHYDROGENASE 9

CGSNL Gene Symbol

CKX9

CGSNL Gene Name

CYTOKININ OXIDASE/DEHYDROGENASE 9

Oryzabase Gene Symbol Synonym(s)

OsCKX9

Oryzabase Gene Name Synonym(s)

cytokinin oxidase 9

Transcript Evidence

AK450260 (Wheat FLcDNA)

Protein Evidence

Q75K78

Literature

PMID: 31235564

PMID: 15976269

Note

Manual Curation

August 1, 2019

Gene Ontology (GO)

Biological Process: cytokinin metabolic process (GO:0009690)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: oxidoreductase activity (GO:0016491)

Molecular Function: cytokinin dehydrogenase activity (GO:0019139)

Molecular Function: flavin adenine dinucleotide binding (GO:0050660)

Molecular Function: FAD binding (GO:0071949)

Functional domain (InterPro)

FAD-binding, type PCMH, subdomain 1 (IPR016167)

FAD-binding, type PCMH-like superfamily (IPR036318)

FAD-binding, type PCMH, subdomain 2 (IPR016169)

FAD-linked oxidase-like, C-terminal (IPR016164)

Cytokinin dehydrogenase, C-terminal domain superfamily (IPR016170)

FAD-binding domain, PCMH-type (IPR016166)

FAD linked oxidase, N-terminal (IPR006094)

Cytokinin dehydrogenase 1, FAD/cytokinin binding domain (IPR015345)

Oxygen oxidoreductase covalent FAD-binding site (IPR006093)

Experimentally confirmed subcellular location

nucleus, cytosol

Expression Databases

TENOR (Os05t0374200-00)

Others

Oryzabase (8399)

Transcript

1836 bp

>Os05t0374200-01 Cytokinin oxidase, Regulation of cytokinin signaling pathway, "Regulation of tillering, plant height, and panicle size"
GGGAAGAAACTTAATCAGATATGCTTGAGAGGAGGCTTGCCACTTGTAAATATGAAAGCA
CAGAGATAGCACTTTGGCTCATCCTCGCAAAGACCAACATGAATTTTTGCATGAGAAATC
GAATTTGAGGGATCAAGCAGGCCTGCTCAGGAGCAACCAGGTTTGCCACTTGAATACCTG
ATATCACTTCTTTTTCCCTACATATGACTTCATCAGAATCTCAATCCTTCTGAGATCCAC
ACCAGAAGAGCCATGAGGCCATCACTCTTGCAGTATCTGAAGCTGCTCCTGTTACTTGCC
CTTGGTGGTGTCACCACCATGCATGTGCCTAAACAAGATGTGCCATCATCCCTGGAGGAA
CTCACCCTTGATGGCCATTTCAGCTTCCACGATGTGTCTGCTGCTGCACAGGACTTTGGC
AACCTGTCCAGCTTCCCGCCGGTTGCGGTGCTTCATCCTGGCTCAGTGGCTGACATTGCC
ACAACCATCAGGCATGTGTTCTTGATGGGTGAGCACTCCACGCTCACAGTGGCAGCCCGT
GGACATGGGCACTCGCTGTATGGGCAGTCCCAGGCTGCTGAGGGAATCATCATCAGTATG
GAATCCCTCCAGAGTAACACAATGAGGGTGAACCCTGGCGTATCACCCTATGTCGATGCT
TCAGGAGGAGAACTCTGGATAAATGTTTTGCATGAGACTCTGAAGTATGGTTTAGCACCA
AAGTCGTGGACGGACTATCTCCATCTCACGGTTGGAGGCACACTGTCGAATGCAGGAGTC
AGTGGGCAGACCTTCCGGCATGGCCCACAGATCAGCAATGTCAACGAGCTGGAAATTGTG
ACTGGAAGAGGTGATGTTATCACATGCTCACCTGAACAAAACTCTGATCTCTTCCATGCT
GCCCTTGGTGGCCTAGGTCAGTTTGGCGTCATCACAAGAGCCAGGATTCCTCTTGAACCT
GCTCCAAAAATGGTAAGGTGGCTACGAGTTCTCTACTTGGATTTCACAAGCTTCACCGAA
GACCAGGAAATGCTCATTTCAGCAGAGAAGACATTTGACTACATCGAGGGCTTTGTCATC
ATAAATAGGACAGGCATCCTGAACAACTGGAGGTCGTCCTTCAATCCGCAGGACCCAGTG
CGTTCTAGCCAGTTTGAATCAGATGGAAAAGTGCTCTTCTGCCTTGAGATGACAAAGAAC
TTCAACCCTGACGAGGCTGATGTCATGGAACAGGAGGTCAACACACTGCTGTCTCAACTT
AGATATATGCCTTCCTCCTTATTCCACACGGATGTAACATACATAGAGTTCTTGGATAGG
GTACACTCTTCTGAGATGAAGTTGAGAGCTAAGGGCATGtgggaagtcccacacccatgg
cttaatatcatcattccaagaagcatgatccataaatttgcgaaggaggtctttgggaaa
atcctgaaagacagtaacaatggtcccatattactctatccagtgaacaaatccagatgg
gacaacagaacatcagtagtcataccagatgaggaagttttctacctggtggcattccta
tcctcagcacttggcccccataacatcaaacatacattggacctgaactacaggataata
gagttctctgacaaggcaggtattggagtgaagcagtatctcccaaactataccacagaa
caggagtggcagtcccattttggtgcaaggtgggacacatttcaacagaggaaaaaagcc
tatgaccccttggccatcttagctccaggacaaagaatatttcaaaaggcatcagcgtca
ctacccttgccctcatgacagtatctaatgtaaata

CDS

1566 bp

>Os05t0374200-01 Cytokinin oxidase, Regulation of cytokinin signaling pathway, "Regulation of tillering, plant height, and panicle size"
ATGAGGCCATCACTCTTGCAGTATCTGAAGCTGCTCCTGTTACTTGCCCTTGGTGGTGTC
ACCACCATGCATGTGCCTAAACAAGATGTGCCATCATCCCTGGAGGAACTCACCCTTGAT
GGCCATTTCAGCTTCCACGATGTGTCTGCTGCTGCACAGGACTTTGGCAACCTGTCCAGC
TTCCCGCCGGTTGCGGTGCTTCATCCTGGCTCAGTGGCTGACATTGCCACAACCATCAGG
CATGTGTTCTTGATGGGTGAGCACTCCACGCTCACAGTGGCAGCCCGTGGACATGGGCAC
TCGCTGTATGGGCAGTCCCAGGCTGCTGAGGGAATCATCATCAGTATGGAATCCCTCCAG
AGTAACACAATGAGGGTGAACCCTGGCGTATCACCCTATGTCGATGCTTCAGGAGGAGAA
CTCTGGATAAATGTTTTGCATGAGACTCTGAAGTATGGTTTAGCACCAAAGTCGTGGACG
GACTATCTCCATCTCACGGTTGGAGGCACACTGTCGAATGCAGGAGTCAGTGGGCAGACC
TTCCGGCATGGCCCACAGATCAGCAATGTCAACGAGCTGGAAATTGTGACTGGAAGAGGT
GATGTTATCACATGCTCACCTGAACAAAACTCTGATCTCTTCCATGCTGCCCTTGGTGGC
CTAGGTCAGTTTGGCGTCATCACAAGAGCCAGGATTCCTCTTGAACCTGCTCCAAAAATG
GTAAGGTGGCTACGAGTTCTCTACTTGGATTTCACAAGCTTCACCGAAGACCAGGAAATG
CTCATTTCAGCAGAGAAGACATTTGACTACATCGAGGGCTTTGTCATCATAAATAGGACA
GGCATCCTGAACAACTGGAGGTCGTCCTTCAATCCGCAGGACCCAGTGCGTTCTAGCCAG
TTTGAATCAGATGGAAAAGTGCTCTTCTGCCTTGAGATGACAAAGAACTTCAACCCTGAC
GAGGCTGATGTCATGGAACAGGAGGTCAACACACTGCTGTCTCAACTTAGATATATGCCT
TCCTCCTTATTCCACACGGATGTAACATACATAGAGTTCTTGGATAGGGTACACTCTTCT
GAGATGAAGTTGAGAGCTAAGGGCATGtgggaagtcccacacccatggcttaatatcatc
attccaagaagcatgatccataaatttgcgaaggaggtctttgggaaaatcctgaaagac
agtaacaatggtcccatattactctatccagtgaacaaatccagatgggacaacagaaca
tcagtagtcataccagatgaggaagttttctacctggtggcattcctatcctcagcactt
ggcccccataacatcaaacatacattggacctgaactacaggataatagagttctctgac
aaggcaggtattggagtgaagcagtatctcccaaactataccacagaacaggagtggcag
tcccattttggtgcaaggtgggacacatttcaacagaggaaaaaagcctatgaccccttg
gccatcttagctccaggacaaagaatatttcaaaaggcatcagcgtcactacccttgccc
tcatga

Protein

522 aa

>Os05t0374200-01 Cytokinin oxidase, Regulation of cytokinin signaling pathway, "Regulation of tillering, plant height, and panicle size"
MRPSLLQYLKLLLLLALGGVTTMHVPKQDVPSSLEELTLDGHFSFHDVSAAAQDFGNLSS
FPPVAVLHPGSVADIATTIRHVFLMGEHSTLTVAARGHGHSLYGQSQAAEGIIISMESLQ
SNTMRVNPGVSPYVDASGGELWINVLHETLKYGLAPKSWTDYLHLTVGGTLSNAGVSGQT
FRHGPQISNVNELEIVTGRGDVITCSPEQNSDLFHAALGGLGQFGVITRARIPLEPAPKM
VRWLRVLYLDFTSFTEDQEMLISAEKTFDYIEGFVIINRTGILNNWRSSFNPQDPVRSSQ
FESDGKVLFCLEMTKNFNPDEADVMEQEVNTLLSQLRYMPSSLFHTDVTYIEFLDRVHSS
EMKLRAKGMWEVPHPWLNIIIPRSMIHKFAKEVFGKILKDSNNGPILLYPVNKSRWDNRT
SVVIPDEEVFYLVAFLSSALGPHNIKHTLDLNYRIIEFSDKAGIGVKQYLPNYTTEQEWQ
SHFGARWDTFQQRKKAYDPLAILAPGQRIFQKASASLPLPS*

5'UTR

chr05:18032481..18032723 (+ strand) : 243 bp

chr05:18033242..18033250 (+ strand) : 9 bp

CDS

chr05:18033251..18033842 (+ strand) : 592 bp

chr05:18033921..18034048 (+ strand) : 128 bp

chr05:18034132..18034392 (+ strand) : 261 bp

chr05:18034494..18034756 (+ strand) : 263 bp

chr05:18034841..18035162 (+ strand) : 322 bp

3'UTR

chr05:18035163..18035180 (+ strand) : 18 bp

FASTA

>Os05t0374200-01 class=Sequence position=chr05:18032481..18035180 (+ strand)
GGGAAGAAAC TTAATCAGAT ATGCTTGAGA GGAGGCTTGC CACTTGTAAA TATGAAAGCA CAGAGATAGC ACTTTGGCTC
ATCCTCGCAA AGACCAACAT GAATTTTTGC ATGAGAAATC GAATTTGAGG GATCAAGCAG GCCTGCTCAG GAGCAACCAG
GTTTGCCACT TGAATACCTG ATATCACTTC TTTTTCCCTA CATATGACTT CATCAGAATC TCAATCCTTC TGAGATCCAC
ACCAGATACA CGCTCAAAAC CCATCTCTGT TCACTGCACC TGCTTGATCT CTTCTATGTC ACTGTTCCTC TGAACAAGCT
GTAGTGAAAG ATATGTACTG TGATAGACTG AGTTTACTAA ACGAATGCAT CATTTTTTCC CTGCATCCAA TCACTTACTG
ACAGATGCTG CACCATGCTT GAAACAGAAG CCAAGGAAGA AAGAACATTA GCATCTCAAA TAGAGCCATC AACCACCGCA
ACATAGCTTC CTCCAAAAGA AACATGTATT CTTCCAAATT TTGTAAGCAG CACATCCTCA CATGGGTTTC TAGTCTACCA
AACAGTGCCC AATACCGGTT TGACCACGCC ACTTCCTGCA CCAGTCCACA TACATACCCT TCAAGGTTTT CCTTTAAATC
TCCTTCTCTC CCTCCATCTC CACTCCCATC CCTCTGCTCT TGGCAGTGAA CAACTGTCCT CCTGCACATT TTGTCTTCCT
CTCAAAACAT TGCCACAGAA TATTGTTCAT TCTTGACACG TAGAAGAGCC ATGAGGCCAT CACTCTTGCA GTATCTGAAG
CTGCTCCTGT TACTTGCCCT TGGTGGTGTC ACCACCATGC ATGTGCCTAA ACAAGATGTG CCATCATCCC TGGAGGAACT
CACCCTTGAT GGCCATTTCA GCTTCCACGA TGTGTCTGCT GCTGCACAGG ACTTTGGCAA CCTGTCCAGC TTCCCGCCGG
TTGCGGTGCT TCATCCTGGC TCAGTGGCTG ACATTGCCAC AACCATCAGG CATGTGTTCT TGATGGGTGA GCACTCCACG
CTCACAGTGG CAGCCCGTGG ACATGGGCAC TCGCTGTATG GGCAGTCCCA GGCTGCTGAG GGAATCATCA TCAGTATGGA
ATCCCTCCAG AGTAACACAA TGAGGGTGAA CCCTGGCGTA TCACCCTATG TCGATGCTTC AGGAGGAGAA CTCTGGATAA
ATGTTTTGCA TGAGACTCTG AAGTATGGTT TAGCACCAAA GTCGTGGACG GACTATCTCC ATCTCACGGT TGGAGGCACA
CTGTCGAATG CAGGAGTCAG TGGGCAGACC TTCCGGCATG GCCCACAGAT CAGCAATGTC AACGAGCTGG AAATTGTGAC
TGGTATGAGA GAGACCTATA TAGCATGACG ATTTGAACAA TTTAATGTAA CTAACTCTCT ATAATGACTG GCAAATGCAG
GAAGAGGTGA TGTTATCACA TGCTCACCTG AACAAAACTC TGATCTCTTC CATGCTGCCC TTGGTGGCCT AGGTCAGTTT
GGCGTCATCA CAAGAGCCAG GATTCCTCTT GAACCTGCTC CAAAAATGGT AAGCGAAACA ATTAAGTCAT GTCAGCTTGA
TGATATTAGC ATTTCAATAG CATACTCATG AGTTAATCAG ATGGATGACA GGTAAGGTGG CTACGAGTTC TCTACTTGGA
TTTCACAAGC TTCACCGAAG ACCAGGAAAT GCTCATTTCA GCAGAGAAGA CATTTGACTA CATCGAGGGC TTTGTCATCA
TAAATAGGAC AGGCATCCTG AACAACTGGA GGTCGTCCTT CAATCCGCAG GACCCAGTGC GTTCTAGCCA GTTTGAATCA
GATGGAAAAG TGCTCTTCTG CCTTGAGATG ACAAAGAACT TCAACCCTGA CGAGGCTGAT GTCATGGAAC AGGTGAGCCA
ACCATTACCC TTATGTCACT AAAGATGTTT ATAAACCAAG TAAAATGAGG TCAAGTTTGA GTGGTTGAAT TCTGTATGTA
TATATGTTTA CAGGAGGTCA ACACACTGCT GTCTCAACTT AGATATATGC CTTCCTCCTT ATTCCACACG GATGTAACAT
ACATAGAGTT CTTGGATAGG GTACACTCTT CTGAGATGAA GTTGAGAGCT AAGGGCATGt gggaagtccc acacccatgg
cttaatatca tcattccaag aagcatgatc cataaatttg cgaaggaggt ctttgggaaa atcctgaaag acagtaacaa
tggtcccata ttactctatc cagtgaacaa atccaggtaa caagctttgt ctctgaatca cagataccat ggagatgcat
cattaagtga ataaccattc ttgttaatca tttcatgcag atgggacaac agaacatcag tagtcatacc agatgaggaa
gttttctacc tggtggcatt cctatcctca gcacttggcc cccataacat caaacataca ttggacctga actacaggat
aatagagttc tctgacaagg caggtattgg agtgaagcag tatctcccaa actataccac agaacaggag tggcagtccc
attttggtgc aaggtgggac acatttcaac agaggaaaaa agcctatgac cccttggcca tcttagctcc aggacaaaga
atatttcaaa aggcatcagc gtcactaccc ttgccctcat gacagtatct aatgtaaata