Os05t0376800-01

Locus

Os05g0376800

Description

Gibberellin regulated protein family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK106775 (DDBJ, Best hit)

Protein Evidence

B6TR96 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Full-length cDNA

002-115-G05 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0376800-01)

RiceXPro (AK106775)

Others

KEGG (Os05t0376800-01)

Transcript

1086 bp

>Os05t0376800-01 Gibberellin regulated protein family protein.
ATTTCGGTGCTTTCGGCTGGCTGCACAGCACAGCCACAGGAGAGCTAGCTCTCATCACGG
GCCAAATCCAAGGGGGATATCGTATTTCCTGTGCATCGATCGTTTGCTCATTCACGAGCT
CACAGACTCAGAGTCTCACAGGGAGATCAAGGAGTCGGAGAAACCTCCTCTGCCTTGCAT
GCCAGTGAGTGAGTGCGAGAGATAGGTTCACTTCAGGGTGGTTATTGGGGTGAGCACCTG
AGCTGATCAGCAGCCATGGAGGGCGTCGGTGTTGGGGTTAGAATTAGAGCGCTGCTCTGC
TGCATTGCGATGGCGGCGATGCTTCTCAGTTCCTACCAGCAAGGCCAGGCCGAGGCCTCT
TACATGCCATGGCCGCCAGCTACGCCGCCGCCACCTGCTGCTGCCGCTGCCAACTCCACC
TCCACCGCGGCGGCGAACAACTCGTCGTCGTCGTCGTCCACCACCGCGCCGCCGCAGCAG
CCGACCGCCTTCCCCATGTACGGCGTGACCCCCGGCAGCCTCCGGCCGCAAGAGTGCGGG
GGTCGGTGCGCGTACAGGTGCTCGGCGACGGCGTACAGGAAGCCGTGCATGTTCTTCTGC
CAGAAGTGCTGCGCCTCCTGCCTCTGCGTGCTGCCGGGGACCTACGGCAACAAGCAGTCG
TGCCCCTGCTACAACGATTGGAAGACCAAGCGAGGAGGCCCCAAGTGCCCCTAGTTAATT
CTTTTTTTTTTCATTTTAGCAGCAAATTAAACCACCATTGTTGAGGGAGGGAGGGAGGGA
GGGAGGAAGGAAGCCGCCATGGCTGCAAGCTTTTCAGCCTTTGCTCTGAGCTAAGGCACG
GCCCTCATGCATCCAGAGTTTGTTGAAATTCAGATGCGACTCTCTGTGTTCTTTTCCTCT
TGTTTTTTTTTTCTGTTCTTTTTGGGGTATCTCTGCTAGAGTGGTTGTTTGTCTGTATTG
ATTTCGTGGATCTTAAGGTAGAAGATGAGTTGTCGAGATGAATTTTGATCGTGATGTGTT
TCGAGTTTGTTTGTAATTTGTATGCAGTATTGAGGAGTAATTTGTATGCTACTATGGGTT
CTTTTC

CDS

459 bp

>Os05t0376800-01 Gibberellin regulated protein family protein.
ATGGAGGGCGTCGGTGTTGGGGTTAGAATTAGAGCGCTGCTCTGCTGCATTGCGATGGCG
GCGATGCTTCTCAGTTCCTACCAGCAAGGCCAGGCCGAGGCCTCTTACATGCCATGGCCG
CCAGCTACGCCGCCGCCACCTGCTGCTGCCGCTGCCAACTCCACCTCCACCGCGGCGGCG
AACAACTCGTCGTCGTCGTCGTCCACCACCGCGCCGCCGCAGCAGCCGACCGCCTTCCCC
ATGTACGGCGTGACCCCCGGCAGCCTCCGGCCGCAAGAGTGCGGGGGTCGGTGCGCGTAC
AGGTGCTCGGCGACGGCGTACAGGAAGCCGTGCATGTTCTTCTGCCAGAAGTGCTGCGCC
TCCTGCCTCTGCGTGCTGCCGGGGACCTACGGCAACAAGCAGTCGTGCCCCTGCTACAAC
GATTGGAAGACCAAGCGAGGAGGCCCCAAGTGCCCCTAG

Protein

152 aa

>Os05t0376800-01 Gibberellin regulated protein family protein.
MEGVGVGVRIRALLCCIAMAAMLLSSYQQGQAEASYMPWPPATPPPPAAAAANSTSTAAA
NNSSSSSSTTAPPQQPTAFPMYGVTPGSLRPQECGGRCAYRCSATAYRKPCMFFCQKCCA
SCLCVLPGTYGNKQSCPCYNDWKTKRGGPKCP*

5'UTR

chr05:18184937..18185191 (- strand) : 255 bp

CDS

chr05:18184844..18184936 (- strand) : 93 bp

chr05:18184598..18184747 (- strand) : 150 bp

chr05:18184481..18184514 (- strand) : 34 bp

chr05:18184195..18184376 (- strand) : 182 bp

3'UTR

chr05:18183823..18184194 (- strand) : 372 bp

FASTA

>Os05t0376800-01 class=Sequence position=chr05:18183823..18185191 (- strand)
ATTTCGGTGC TTTCGGCTGG CTGCACAGCA CAGCCACAGG AGAGCTAGCT CTCATCACGG GCCAAATCCA AGGGGGATAT
CGTATTTCCT GTGCATCGAT CGTTTGCTCA TTCACGAGCT CACAGACTCA GAGTCTCACA GGGAGATCAA GGAGTCGGAG
AAACCTCCTC TGCCTTGCAT GCCAGTGAGT GAGTGCGAGA GATAGGTTCA CTTCAGGGTG GTTATTGGGG TGAGCACCTG
AGCTGATCAG CAGCCATGGA GGGCGTCGGT GTTGGGGTTA GAATTAGAGC GCTGCTCTGC TGCATTGCGA TGGCGGCGAT
GCTTCTCAGT TCCTACCAGC AAGGCCAGGT TCTCTATCTT GCTGATGTTG TCTCTTAAGT CTCTCTTTGA ATTGGAAACA
ATTGTCCGGC CTCGTGTATT ATTCTGATAT CTTCTCCATT GAAGGCCGAG GCCTCTTACA TGCCATGGCC GCCAGCTACG
CCGCCGCCAC CTGCTGCTGC CGCTGCCAAC TCCACCTCCA CCGCGGCGGC GAACAACTCG TCGTCGTCGT CGTCCACCAC
CGCGCCGCCG CAGCAGCCGA CCGCCTTCCC CATGGTACGC CCATCAAAAC GATCACAGAT TATGAAATTA ATCCACATTG
CGCTCATTTC GTCCTCCTCT CCGATCCGTT CTTGCAGTAC GGCGTGACCC CCGGCAGCCT CCGGCCGCAA GGTACACGTA
ATCTCCATCG ATCTCTCGCT GAATTAACCA ATCAATTAAG CATTGTTAAC TAGGAGTAAT TAAGTAGCAA TCGGTGGAAT
AATGCTGTTT GGCAGAGTGC GGGGGTCGGT GCGCGTACAG GTGCTCGGCG ACGGCGTACA GGAAGCCGTG CATGTTCTTC
TGCCAGAAGT GCTGCGCCTC CTGCCTCTGC GTGCTGCCGG GGACCTACGG CAACAAGCAG TCGTGCCCCT GCTACAACGA
TTGGAAGACC AAGCGAGGAG GCCCCAAGTG CCCCTAGTTA ATTCTTTTTT TTTTCATTTT AGCAGCAAAT TAAACCACCA
TTGTTGAGGG AGGGAGGGAG GGAGGGAGGA AGGAAGCCGC CATGGCTGCA AGCTTTTCAG CCTTTGCTCT GAGCTAAGGC
ACGGCCCTCA TGCATCCAGA GTTTGTTGAA ATTCAGATGC GACTCTCTGT GTTCTTTTCC TCTTGTTTTT TTTTTCTGTT
CTTTTTGGGG TATCTCTGCT AGAGTGGTTG TTTGTCTGTA TTGATTTCGT GGATCTTAAG GTAGAAGATG AGTTGTCGAG
ATGAATTTTG ATCGTGATGT GTTTCGAGTT TGTTTGTAAT TTGTATGCAG TATTGAGGAG TAATTTGTAT GCTACTATGG
GTTCTTTTC

Locus: Os05g0376800

Loading...

Locus: Os05g0376800

Loading...