Os05t0393700-01

Locus

Os05g0393700

Description

Starch-debranching enzyme, Isoamylase, Starch biosynthesis as the ISA1-ISA2 hetero-oligomer in leaf

RAP-DB Gene Symbol Synonym(s)

OsISA2, ISA2

RAP-DB Gene Name Synonym(s)

isoamylase 2

CGSNL Gene Symbol

ISA2

CGSNL Gene Name

ISOAMYLASE 2

Oryzabase Gene Symbol Synonym(s)

OsISA2, ISA II, OsISA II

Oryzabase Gene Name Synonym(s)

isoamylase-2, isoamylase 2

Transcript Evidence

AK288307 (truncated)

Q6AU80 (UniProt)

Protein Evidence

Q6AU80

Literature

PMID: 21436381

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

September 14, 2020

Gene Ontology (GO)

Biological Process: carbohydrate metabolic process (GO:0005975)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: hydrolase activity, hydrolyzing O-glycosyl compounds (GO:0004553)

Functional domain (InterPro)

Immunoglobulin-like fold (IPR013783)

Immunoglobulin E-set (IPR014756)

Glycoside hydrolase superfamily (IPR017853)

Glycosyl hydrolase, all-beta (IPR013780)

Glycoside hydrolase, family 13, N-terminal (IPR004193)

Glycosyl hydrolase, family 13, catalytic domain (IPR006047)

Full-length cDNA

J090020G01(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os05t0393700-01)

Others

Oryzabase (6179)

Transcript

2548 bp

>Os05t0393700-01 Starch-debranching enzyme, Isoamylase, Starch biosynthesis as the ISA1-ISA2 hetero-oligomer in leaf
ATGGCGTCCCTCCCCGCGCCGCCCACGCCGCTCGGCTCCTGCCCCCGCGGCCGCGGCGGC
GGAAGAGTTGTAGCGCGGCCCCGTCGCGCGGGTCTCGCCTGCGCCGCGCGGTCGTGCTAC
CGCTTCCGGACCGACGACGACGGCGTGGTGGACGTGGCCGTCTCCGGGGAGGATGGGGAC
GGCGGCGGCGGGGGGTACGCGGTGTCCGTCGAGGTCCCTGGCACTCGCGGGCGGGAGGGC
GGGCTAGTGCTCCGCGCCTCGGGGTCCGGCGAGGGCGTCCCGCTGGCGCCGGCCGCCGGC
GGCGCCTCCCTCGCGGCCGAGCTCTCCTTCGACCCGACCCGCGCGCCGTTCTACCTCTCG
TTCCTGCTCACGGACGCGTCGGGGGCGGAGATACGGACGCACCGCAAGACGAGCTTCCGC
GTGCCCGTCGGCGTCGGGCCGGGCAGCCCCGCGCCGCTCGGCATGTCTATCTCAGGCGAC
GGCGCCGTCAATTTCGCGGTGTACAGCAAGAATGCCAATGCCGTTTCTCTCTACCTCTAC
GCCGCCGCCGTCGGCGGCGGCGGCGGCGACGAGCCCGCGCTGGAGATCGACCTCGATCCG
TACATCCACCGGACTGGCAACGTCTGGCATGTCTCTCTGGCGAGCGTAGATGGGTACGTC
AGCTATGCCTTCTGCTGCGGTGGCATCCGCCGCCCACTGTTGGACCCGTACGCCAAGGTG
ATCGGAGACTTCGTCTCCAGCAACTCGGTTTACGACGAGGGTGTCACTGCGCCGTCAATG
AGGTGCTTTGCATCGTTGGCGATTGCGCCGAGCTACAACTGGGGAAGGGACAGGCACCCC
CGTCTGCCATTGGAGAAGCTGGTGGTGTACCGGGCAAATGTGGCTTTGTTCACAAAGGAC
AGGTCGAGCGGGCTCCCGGATGACGCTGCCGGCACTTTCACCGGGCTTTCTGCTAAGGTA
GAGCACTTCAGGAGCCTTGGTGTCAATGCAATTTTGCTGGAACCAGTGTTCCCATTTCAT
CAGGTGAAAGGACCTTATTTCCCGTACCATTTCTTTTCACCGATGAACTTGTATAGCAGC
AAAGGTTTGAGTGTTTCAGCCATCAAGTCCATGAAGGATATGGTCAGGGTAATGCATAGA
AATGGAATAGAGGTCCTCTTGGAGGTGGTTTTTACACATACTGCTGAGGGAGAATCAGAG
TGTCAGACGATATCAATGCGTGGCATTGATAATTCCTCGTATTACATTGCCAATGGGATC
GCAGGATGCAAAGCGAGCATACTGAATTGCAACCATCCGGTGACTCAGAAGCTGATTTTG
GACAGCCTCCGCCATTGGGTGCTTGACTTCCATGTTGATGGGTTTTGCTTCATCAATGCC
CCTTTCCTTGTGAGAGGTCCTGGTGGTGAATATTTATCTCGACCTCCCCTTCTTGAGGCG
ATAACTTTTGACCCGGTTCTTTCCATGACAAAGATCATTGCAGATCCTTGGTCTCCACTT
GACATATCTAACGTGCAATTCCCATTCCCTCATTGGAAAAGATGGGCTGAGGTGAACACA
AGATTCTCTATTGATGTGCGCAAATTTTTGAAGAGAGAAGCACTTATTAGTGATCTTGCT
ACACGCCTGTGCGGCAGTGGGGACCTGTTCTCAACCAGAGGGCCTGCATTTTCATTCAAT
CATGTATCCAGGAATTCAGGGCTTTCTCTTGTTGATCTGGTGAGTTTCAGCAATGATGAT
CTTCTTTCTGAGTCGAGCTGGAATTGTGGTGAAGAAGGTCCATCAGAGAACAGTGCTGTC
CTTCAGACAAGGCTAAGGCAGATACGCAACTTCTTATTTATTCTATTTGTATCACTTGGT
GTTCCTGTTCTGAACATGGGAGATGAATGTGGGCACTCTGCTGCTGGTTCAGTATCATAC
AAGGATAGAGGGCCTCTGAACTGGAGAGGCATGAAGACAACATTTGTTAAGGAAGTGACC
GGATTCATTTCATTTCTAACTGCACTCAGGAGTCGGCGAGGCGATATCTTTCAGAGAAGG
GAATTCCTAAAACTTGAGAATATACATTGGTATGGGAGCGATCTATGTGAGCCAGGTTGG
GATGATCCTACCAGCAACTTTCTTTGCATGCACATAAATGCAGAGGTAGATGAAATGGCG
GCAGATTCGGTCAGAGGCGACCTGTACATCTGTTTCAATGCAAACGAGGAATCAGTGAGT
GCTGCCTTGCCTGCTCTTGCAGAAGGATCCGTGTGGTTGCGCTTGGTTGACACATCACTT
GCATTTCCAGGTTTCTTTGCAACCGAATCTAATCCCAAGGTGCAACAAGTGCCAGGATTA
TCCTCTTATCATGTGGAAGCGCATACTTGTGTTCTATTTGAATCAAAGAGCGCTCTTGCC
TAGTTTCTGCAGTCAAAATAAGGATCACAAACCTATGATAAGTACAAATTTTTGTGTATA
TCTACAGTCAGAAACCTGAGGTCCCAATAAGTTGTAGTGGTTGTATATGAGAATGTTAAT
GATAATAAAAGAATGTATCATTTTCCAG

CDS

2403 bp

>Os05t0393700-01 Starch-debranching enzyme, Isoamylase, Starch biosynthesis as the ISA1-ISA2 hetero-oligomer in leaf
ATGGCGTCCCTCCCCGCGCCGCCCACGCCGCTCGGCTCCTGCCCCCGCGGCCGCGGCGGC
GGAAGAGTTGTAGCGCGGCCCCGTCGCGCGGGTCTCGCCTGCGCCGCGCGGTCGTGCTAC
CGCTTCCGGACCGACGACGACGGCGTGGTGGACGTGGCCGTCTCCGGGGAGGATGGGGAC
GGCGGCGGCGGGGGGTACGCGGTGTCCGTCGAGGTCCCTGGCACTCGCGGGCGGGAGGGC
GGGCTAGTGCTCCGCGCCTCGGGGTCCGGCGAGGGCGTCCCGCTGGCGCCGGCCGCCGGC
GGCGCCTCCCTCGCGGCCGAGCTCTCCTTCGACCCGACCCGCGCGCCGTTCTACCTCTCG
TTCCTGCTCACGGACGCGTCGGGGGCGGAGATACGGACGCACCGCAAGACGAGCTTCCGC
GTGCCCGTCGGCGTCGGGCCGGGCAGCCCCGCGCCGCTCGGCATGTCTATCTCAGGCGAC
GGCGCCGTCAATTTCGCGGTGTACAGCAAGAATGCCAATGCCGTTTCTCTCTACCTCTAC
GCCGCCGCCGTCGGCGGCGGCGGCGGCGACGAGCCCGCGCTGGAGATCGACCTCGATCCG
TACATCCACCGGACTGGCAACGTCTGGCATGTCTCTCTGGCGAGCGTAGATGGGTACGTC
AGCTATGCCTTCTGCTGCGGTGGCATCCGCCGCCCACTGTTGGACCCGTACGCCAAGGTG
ATCGGAGACTTCGTCTCCAGCAACTCGGTTTACGACGAGGGTGTCACTGCGCCGTCAATG
AGGTGCTTTGCATCGTTGGCGATTGCGCCGAGCTACAACTGGGGAAGGGACAGGCACCCC
CGTCTGCCATTGGAGAAGCTGGTGGTGTACCGGGCAAATGTGGCTTTGTTCACAAAGGAC
AGGTCGAGCGGGCTCCCGGATGACGCTGCCGGCACTTTCACCGGGCTTTCTGCTAAGGTA
GAGCACTTCAGGAGCCTTGGTGTCAATGCAATTTTGCTGGAACCAGTGTTCCCATTTCAT
CAGGTGAAAGGACCTTATTTCCCGTACCATTTCTTTTCACCGATGAACTTGTATAGCAGC
AAAGGTTTGAGTGTTTCAGCCATCAAGTCCATGAAGGATATGGTCAGGGTAATGCATAGA
AATGGAATAGAGGTCCTCTTGGAGGTGGTTTTTACACATACTGCTGAGGGAGAATCAGAG
TGTCAGACGATATCAATGCGTGGCATTGATAATTCCTCGTATTACATTGCCAATGGGATC
GCAGGATGCAAAGCGAGCATACTGAATTGCAACCATCCGGTGACTCAGAAGCTGATTTTG
GACAGCCTCCGCCATTGGGTGCTTGACTTCCATGTTGATGGGTTTTGCTTCATCAATGCC
CCTTTCCTTGTGAGAGGTCCTGGTGGTGAATATTTATCTCGACCTCCCCTTCTTGAGGCG
ATAACTTTTGACCCGGTTCTTTCCATGACAAAGATCATTGCAGATCCTTGGTCTCCACTT
GACATATCTAACGTGCAATTCCCATTCCCTCATTGGAAAAGATGGGCTGAGGTGAACACA
AGATTCTCTATTGATGTGCGCAAATTTTTGAAGAGAGAAGCACTTATTAGTGATCTTGCT
ACACGCCTGTGCGGCAGTGGGGACCTGTTCTCAACCAGAGGGCCTGCATTTTCATTCAAT
CATGTATCCAGGAATTCAGGGCTTTCTCTTGTTGATCTGGTGAGTTTCAGCAATGATGAT
CTTCTTTCTGAGTCGAGCTGGAATTGTGGTGAAGAAGGTCCATCAGAGAACAGTGCTGTC
CTTCAGACAAGGCTAAGGCAGATACGCAACTTCTTATTTATTCTATTTGTATCACTTGGT
GTTCCTGTTCTGAACATGGGAGATGAATGTGGGCACTCTGCTGCTGGTTCAGTATCATAC
AAGGATAGAGGGCCTCTGAACTGGAGAGGCATGAAGACAACATTTGTTAAGGAAGTGACC
GGATTCATTTCATTTCTAACTGCACTCAGGAGTCGGCGAGGCGATATCTTTCAGAGAAGG
GAATTCCTAAAACTTGAGAATATACATTGGTATGGGAGCGATCTATGTGAGCCAGGTTGG
GATGATCCTACCAGCAACTTTCTTTGCATGCACATAAATGCAGAGGTAGATGAAATGGCG
GCAGATTCGGTCAGAGGCGACCTGTACATCTGTTTCAATGCAAACGAGGAATCAGTGAGT
GCTGCCTTGCCTGCTCTTGCAGAAGGATCCGTGTGGTTGCGCTTGGTTGACACATCACTT
GCATTTCCAGGTTTCTTTGCAACCGAATCTAATCCCAAGGTGCAACAAGTGCCAGGATTA
TCCTCTTATCATGTGGAAGCGCATACTTGTGTTCTATTTGAATCAAAGAGCGCTCTTGCC
TAG

Protein

801 aa

>Os05t0393700-01 Starch-debranching enzyme, Isoamylase, Starch biosynthesis as the ISA1-ISA2 hetero-oligomer in leaf
MASLPAPPTPLGSCPRGRGGGRVVARPRRAGLACAARSCYRFRTDDDGVVDVAVSGEDGD
GGGGGYAVSVEVPGTRGREGGLVLRASGSGEGVPLAPAAGGASLAAELSFDPTRAPFYLS
FLLTDASGAEIRTHRKTSFRVPVGVGPGSPAPLGMSISGDGAVNFAVYSKNANAVSLYLY
AAAVGGGGGDEPALEIDLDPYIHRTGNVWHVSLASVDGYVSYAFCCGGIRRPLLDPYAKV
IGDFVSSNSVYDEGVTAPSMRCFASLAIAPSYNWGRDRHPRLPLEKLVVYRANVALFTKD
RSSGLPDDAAGTFTGLSAKVEHFRSLGVNAILLEPVFPFHQVKGPYFPYHFFSPMNLYSS
KGLSVSAIKSMKDMVRVMHRNGIEVLLEVVFTHTAEGESECQTISMRGIDNSSYYIANGI
AGCKASILNCNHPVTQKLILDSLRHWVLDFHVDGFCFINAPFLVRGPGGEYLSRPPLLEA
ITFDPVLSMTKIIADPWSPLDISNVQFPFPHWKRWAEVNTRFSIDVRKFLKREALISDLA
TRLCGSGDLFSTRGPAFSFNHVSRNSGLSLVDLVSFSNDDLLSESSWNCGEEGPSENSAV
LQTRLRQIRNFLFILFVSLGVPVLNMGDECGHSAAGSVSYKDRGPLNWRGMKTTFVKEVT
GFISFLTALRSRRGDIFQRREFLKLENIHWYGSDLCEPGWDDPTSNFLCMHINAEVDEMA
ADSVRGDLYICFNANEESVSAALPALAEGSVWLRLVDTSLAFPGFFATESNPKVQQVPGL
SSYHVEAHTCVLFESKSALA*

CDS

chr05:19155198..19157600 (- strand) : 2403 bp

3'UTR

chr05:19155053..19155197 (- strand) : 145 bp

FASTA

>Os05t0393700-01 class=Sequence position=chr05:19155053..19157600 (- strand)
ATGGCGTCCC TCCCCGCGCC GCCCACGCCG CTCGGCTCCT GCCCCCGCGG CCGCGGCGGC GGAAGAGTTG TAGCGCGGCC
CCGTCGCGCG GGTCTCGCCT GCGCCGCGCG GTCGTGCTAC CGCTTCCGGA CCGACGACGA CGGCGTGGTG GACGTGGCCG
TCTCCGGGGA GGATGGGGAC GGCGGCGGCG GGGGGTACGC GGTGTCCGTC GAGGTCCCTG GCACTCGCGG GCGGGAGGGC
GGGCTAGTGC TCCGCGCCTC GGGGTCCGGC GAGGGCGTCC CGCTGGCGCC GGCCGCCGGC GGCGCCTCCC TCGCGGCCGA
GCTCTCCTTC GACCCGACCC GCGCGCCGTT CTACCTCTCG TTCCTGCTCA CGGACGCGTC GGGGGCGGAG ATACGGACGC
ACCGCAAGAC GAGCTTCCGC GTGCCCGTCG GCGTCGGGCC GGGCAGCCCC GCGCCGCTCG GCATGTCTAT CTCAGGCGAC
GGCGCCGTCA ATTTCGCGGT GTACAGCAAG AATGCCAATG CCGTTTCTCT CTACCTCTAC GCCGCCGCCG TCGGCGGCGG
CGGCGGCGAC GAGCCCGCGC TGGAGATCGA CCTCGATCCG TACATCCACC GGACTGGCAA CGTCTGGCAT GTCTCTCTGG
CGAGCGTAGA TGGGTACGTC AGCTATGCCT TCTGCTGCGG TGGCATCCGC CGCCCACTGT TGGACCCGTA CGCCAAGGTG
ATCGGAGACT TCGTCTCCAG CAACTCGGTT TACGACGAGG GTGTCACTGC GCCGTCAATG AGGTGCTTTG CATCGTTGGC
GATTGCGCCG AGCTACAACT GGGGAAGGGA CAGGCACCCC CGTCTGCCAT TGGAGAAGCT GGTGGTGTAC CGGGCAAATG
TGGCTTTGTT CACAAAGGAC AGGTCGAGCG GGCTCCCGGA TGACGCTGCC GGCACTTTCA CCGGGCTTTC TGCTAAGGTA
GAGCACTTCA GGAGCCTTGG TGTCAATGCA ATTTTGCTGG AACCAGTGTT CCCATTTCAT CAGGTGAAAG GACCTTATTT
CCCGTACCAT TTCTTTTCAC CGATGAACTT GTATAGCAGC AAAGGTTTGA GTGTTTCAGC CATCAAGTCC ATGAAGGATA
TGGTCAGGGT AATGCATAGA AATGGAATAG AGGTCCTCTT GGAGGTGGTT TTTACACATA CTGCTGAGGG AGAATCAGAG
TGTCAGACGA TATCAATGCG TGGCATTGAT AATTCCTCGT ATTACATTGC CAATGGGATC GCAGGATGCA AAGCGAGCAT
ACTGAATTGC AACCATCCGG TGACTCAGAA GCTGATTTTG GACAGCCTCC GCCATTGGGT GCTTGACTTC CATGTTGATG
GGTTTTGCTT CATCAATGCC CCTTTCCTTG TGAGAGGTCC TGGTGGTGAA TATTTATCTC GACCTCCCCT TCTTGAGGCG
ATAACTTTTG ACCCGGTTCT TTCCATGACA AAGATCATTG CAGATCCTTG GTCTCCACTT GACATATCTA ACGTGCAATT
CCCATTCCCT CATTGGAAAA GATGGGCTGA GGTGAACACA AGATTCTCTA TTGATGTGCG CAAATTTTTG AAGAGAGAAG
CACTTATTAG TGATCTTGCT ACACGCCTGT GCGGCAGTGG GGACCTGTTC TCAACCAGAG GGCCTGCATT TTCATTCAAT
CATGTATCCA GGAATTCAGG GCTTTCTCTT GTTGATCTGG TGAGTTTCAG CAATGATGAT CTTCTTTCTG AGTCGAGCTG
GAATTGTGGT GAAGAAGGTC CATCAGAGAA CAGTGCTGTC CTTCAGACAA GGCTAAGGCA GATACGCAAC TTCTTATTTA
TTCTATTTGT ATCACTTGGT GTTCCTGTTC TGAACATGGG AGATGAATGT GGGCACTCTG CTGCTGGTTC AGTATCATAC
AAGGATAGAG GGCCTCTGAA CTGGAGAGGC ATGAAGACAA CATTTGTTAA GGAAGTGACC GGATTCATTT CATTTCTAAC
TGCACTCAGG AGTCGGCGAG GCGATATCTT TCAGAGAAGG GAATTCCTAA AACTTGAGAA TATACATTGG TATGGGAGCG
ATCTATGTGA GCCAGGTTGG GATGATCCTA CCAGCAACTT TCTTTGCATG CACATAAATG CAGAGGTAGA TGAAATGGCG
GCAGATTCGG TCAGAGGCGA CCTGTACATC TGTTTCAATG CAAACGAGGA ATCAGTGAGT GCTGCCTTGC CTGCTCTTGC
AGAAGGATCC GTGTGGTTGC GCTTGGTTGA CACATCACTT GCATTTCCAG GTTTCTTTGC AACCGAATCT AATCCCAAGG
TGCAACAAGT GCCAGGATTA TCCTCTTATC ATGTGGAAGC GCATACTTGT GTTCTATTTG AATCAAAGAG CGCTCTTGCC
TAGTTTCTGC AGTCAAAATA AGGATCACAA ACCTATGATA AGTACAAATT TTTGTGTATA TCTACAGTCA GAAACCTGAG
GTCCCAATAA GTTGTAGTGG TTGTATATGA GAATGTTAAT GATAATAAAA GAATGTATCA TTTTCCAG

Locus: Os05g0393700

Loading...

Locus: Os05g0393700

Loading...