Os05t0405900-01

Locus

Os05g0405900

Description

WD40 repeat-like domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG18F

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 18F

Oryzabase Gene Symbol Synonym(s)

OsATG18f, OsWD40-118

Oryzabase Gene Name Synonym(s)

autophagy 18f

Transcript Evidence

AK072244 (DDBJ, Best hit)

Protein Evidence

Q6AVA5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40 repeat, subgroup (IPR019781)

Breast carcinoma amplified sequence 3 (IPR022175)

Full-length cDNA

J023003F07 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0405900-01)

RiceXPro (AK072244)

Others

Oryzabase (9665)

KEGG (Os05t0405900-01)

Transcript

3940 bp

>Os05t0405900-01 WD40 repeat-like domain containing protein.
AGGCACACGAAAGCAACAGCGAGGAGGGGAGAGAGAGAGAGAGAGAGAGAGAGAGGAAAA
GGGAGAAGCCAAGGAGTTGTTGGTTCTGGTCGGAGTCGGAGGAGGAGGAGGAGGAGGAGG
GAGATGGTGGCGAGCTGACTTGGCGGATCGCGGCGGCGGCGGCGGGGGATCGGAGGGGGA
GCAGGGCCACTCGGATGGTATTGGGCTTCGCCGGCGCCGGAGGCGGCGATCGCGGATGGG
CGGCGGGCGGGGCGGGGGCCGGGGGTTGTAGGTGGAGGAGGAGGAGGGGCGGTTCCGGAG
TTTGGGGAGGGGGCGGCGGTGCTCGTGCTGGGGGAGGAGTGGGGAGGAGGAGGAGGAGGG
ATGAGGCGCGGGAAGGGCGGGAGGAACGGGCTGCTGCCGAGCTCGCTGAGGATCATCTCG
TCGTGCCTCAAGACGGTGTCGTCCAACGCCGGCTCCGTCGCGTCCACGGTGCGCTCGGCC
GGCGCCTCCGTCGCCGCCTCCATCGCCCCCCAGGCCGAGGACGAGAAGGACCAGGTATTG
TGGGCTGGATTTGATAAATTAGAGCTTCATCCATCATCTTTCAAGCATGTTTTGCTTGTT
GGTTATTCAAATGGGTTCCAAGTGCTTGATGTTGAGGATGCTGCAAATGTTTGCGAATTG
GTCTCAAAACGTGATGGTCCAGTTACATTTTTACAAATGCAACCCACACCAGTTTACTCT
GATGGTACTGAAGGATTCAGAACATCACATCCCATGCTTCTGGTTGTTGCCGGTGATGAG
ACAAATGGGTCGGGTATGGTTCAAGGTGGTCGCTTAAGTGCACTGATCAGAGATAATAGC
AGTGAAACTCCAAATGGAAATTGCATTTCTACTCCAACAGTTGTTCGCTTCTACTCTTTG
AAGTCTCACTCATATGTACATGTTCTGAGATTTCGGTCTGCCGTATATATAGTTCGCTGC
AGCCCCCGGATTGTAGCTGTAGCTCTTGCAGCACAAGTATACTGCTTTGATGCTGTGACC
CTTGAGAATAAGTTCAGTGTCTTGACATATCCTTTGCAAGGGGCACCTGGGATAAATATT
GGGTATGGCCCAATGGCTGTTGGCCCAAGGTGGTTAGCTTATGCTTCCAATAGCCCTTTA
TTATCAAGCACAGGCCGTCTAAGTCCACAGAACCTTACACCATCTCCAGGAGTTAGCCCA
TCTACCTCCCCTAGTAGTGGAAGTTTAGTTGCTCGGTATGCAATGGAATCAAGTAAGCAG
ATAGCTGCTGGTATTATTAATCTTGGTGATATGGGATACAAGACACTGTCAAAGTACTGC
CAAGAATTTCTGCCAGATGGTTCTGGCTCCCCCTTGTCATCAAGTCCTGGCAGAAGATCT
GGCAAACTTCCCTCTAGCGTGCATCCGCTGGAAGCTGACAATGCTGGAATGGTTGTCATC
AAGGATTTTATCTCGAAAGAAATCATATCTCAGTTTAGGGCTCACACAAGTCCCATATCT
GCTCTTTGTTTTGACCCTAGTGGAACTCTGTTGGTCACAGCCTCCGTTCATGGCCATAAC
ATAAATGTTTTCAGGATCATGCCAACCGTAATAGCTAACAGCTCAGGCTCTATACGCTAT
GATTGGACAGCATCTCATGTCCACCTTTACAAACTGTATCGTGGCATGACAGCAGCTGTC
ATCCAGGATATCTCTTTTAGCCATTTTAGCCAGTGGATATCTATTGTTTCATCCCGAGGT
ACTTGCCATATTTTTACATTGTCTCCTTTTGGCGGTGATGCGAGTCTGCTGCCACAGAAT
TCTCACAGTGATGGGCTACCCCTTGCCCCATGTCAATCAAGGCCATGGTGGTCAAAGCCA
TCATTCCTTATGGATCATCAGCTTCATCCAGCTCCTTCAACTGTAACTAATTCTGTAGTC
AGTAGGATAAAAAACAGTTCTTCTGGTTGGCTAAATACTGTTAGTAATGTGGCTGCTTCT
GCAAGTGGGAAACTATCTGTACCATCTGGCGCTGTTACTGCTGTTTTCCACAATTCCAAC
TATGAAGGTTCATTGCCAGTTCCATCAAAGGCTAATGCCATGGAGCATCTATTGGTGTAT
TCACCATCTGGCCATGTTATTCAACATGAACTACTGCCTTCAGGTTCTGAATCCTCTGAT
AGCAGTCCAATAGTTGGGCCTGGTTCCTTGCAGATCCAAGATGATGAGTTGCATGTTACT
GCTGAACCGACTCAGTGGTGGGATGTATGCCGTAGGACAAACTGGCCAGAAAGGGACGAA
AACATTGCAAACATAGTCTTCCATAATCAACGAAATAGTATGATGGCAATGGATGCTTCT
GACTGTGATAGTGAGCATTCAGATTCCGTTCCATCAGATGGTATTTCTGGGAAAGAGATG
ATGAGATCTCGAGAAAGATCAAGTTGGTACCTCTCAAATGCAGAGGTACAGATAAGTTCA
TGGAGGATTCCCATTTGGCAGAAATCAAAGATTTTCTTCTATGTGATAGATCAACCACCT
GCAAAATCAGGGGAATCTCTTAGCTCTAGTGGGGGAGAGATTGAGATTGAGAAGCTGCCT
CTGCATGAGGTTGAACTTCGGAGGAGGGAATTGCTCCCTGTATTCAAGCAGTTCCACTAT
TCTGAACAGAACTTCAGTGACAGATTCAGGAATCTTGCAATAGGACGGTTTCAGAATGCA
TTGACATACATCGACAAGGATAATGGTGCTCATGGATCCAAGGCGGGGTTCCCTATATCT
GGATTTTACAGTGATATGAGGAAAATGCAGAACATGAATGGTTTAGAGGGGCAGTTATTG
TTGGAACCTATCACTAATGATTTACAACCAATGGAAAAATGCAATTCTGTTCAATCTCCT
AAAGTGGCAAATTTTACTGCCCTTCACAATGTAGATAATGAGAGCATGAACCATGTTTCA
ACAGCAACTGGAGCAACCACATCAGTCACAACAGTGGACACTTTACCTTCAACCATCAGA
CCATTGAGCAGCTACTCCCTCTTGGATGGATCTCTTGATGATGGATTACCATCACCTGCA
AGTAATGTATCATTCAGGCCTCAGATAACCAACAATTCTTCAGTAAGCAATGGTACAATG
ACTGACATCTCAAATGGGTGTCTCACGAGCATCAATTCTGGACAGAATGAAGCATCTGAT
TCTCACAACTCAGTGGAGTTTACCCAGTATTTCCAAGAGGGCTATTGTAAAATATCAGAA
CTCGATGACTGCCGTGAGTTAACTGAAGCTGTTACTGATGCTGACAGCAGCAGCAGCCAC
TGCGAGAGAGAGAAGCCCGAGGAAGATGGGGATAACGATGACATGCTTGGGGCTGTTTTT
GCCTTCAGCGAAGAAGGTTGAACCTAATAATATACTCTGCTTTTACATAGAGAATGGAAA
ACAGTGCCCGTGATATTACCTAGAAAATGGTGGATTTCCATTAGGCTTTCGTGGAATAAA
TTGGTGCTGAGATGATAATCTACTATTTGGTACATATTAGAAAGGTGAAGCTTGTGCTCG
ATATCCATTTGTGAGAAGTTTTACTCAGGAATTGAGATCAAGATCCTTCCTTCCGGGCCA
TTAACTAATCCACGGATCCACGTTAAGGGGAGCTTGGTGTTGTCGAGAAGTTGCTGCTGC
CTGCCGCAACACTGCCCCTTTTCCGTTGCTTTGTACATACTGTAAAAGACCATTTGTTTT
GTGAAATACGTCTCTGGAACATTGGACGGTCCAACTTCCTTGGCAGCCATATTTGTTGAC
TGCTTCCTGCCAAGGCCTGTTAATGTTCCTTGTTTATTTGTACAGTCTTTTCTGTTTCAT
TAAGGAAAAAGAAAATCTAGCAAGGATTAATGTGACATAACTGTATAAACATTCAGTAAA
GAATTTCCGTTTACGAAGAAATGTTAATTGTTTCCCTTGC

CDS

3021 bp

>Os05t0405900-01 WD40 repeat-like domain containing protein.
ATGAGGCGCGGGAAGGGCGGGAGGAACGGGCTGCTGCCGAGCTCGCTGAGGATCATCTCG
TCGTGCCTCAAGACGGTGTCGTCCAACGCCGGCTCCGTCGCGTCCACGGTGCGCTCGGCC
GGCGCCTCCGTCGCCGCCTCCATCGCCCCCCAGGCCGAGGACGAGAAGGACCAGGTATTG
TGGGCTGGATTTGATAAATTAGAGCTTCATCCATCATCTTTCAAGCATGTTTTGCTTGTT
GGTTATTCAAATGGGTTCCAAGTGCTTGATGTTGAGGATGCTGCAAATGTTTGCGAATTG
GTCTCAAAACGTGATGGTCCAGTTACATTTTTACAAATGCAACCCACACCAGTTTACTCT
GATGGTACTGAAGGATTCAGAACATCACATCCCATGCTTCTGGTTGTTGCCGGTGATGAG
ACAAATGGGTCGGGTATGGTTCAAGGTGGTCGCTTAAGTGCACTGATCAGAGATAATAGC
AGTGAAACTCCAAATGGAAATTGCATTTCTACTCCAACAGTTGTTCGCTTCTACTCTTTG
AAGTCTCACTCATATGTACATGTTCTGAGATTTCGGTCTGCCGTATATATAGTTCGCTGC
AGCCCCCGGATTGTAGCTGTAGCTCTTGCAGCACAAGTATACTGCTTTGATGCTGTGACC
CTTGAGAATAAGTTCAGTGTCTTGACATATCCTTTGCAAGGGGCACCTGGGATAAATATT
GGGTATGGCCCAATGGCTGTTGGCCCAAGGTGGTTAGCTTATGCTTCCAATAGCCCTTTA
TTATCAAGCACAGGCCGTCTAAGTCCACAGAACCTTACACCATCTCCAGGAGTTAGCCCA
TCTACCTCCCCTAGTAGTGGAAGTTTAGTTGCTCGGTATGCAATGGAATCAAGTAAGCAG
ATAGCTGCTGGTATTATTAATCTTGGTGATATGGGATACAAGACACTGTCAAAGTACTGC
CAAGAATTTCTGCCAGATGGTTCTGGCTCCCCCTTGTCATCAAGTCCTGGCAGAAGATCT
GGCAAACTTCCCTCTAGCGTGCATCCGCTGGAAGCTGACAATGCTGGAATGGTTGTCATC
AAGGATTTTATCTCGAAAGAAATCATATCTCAGTTTAGGGCTCACACAAGTCCCATATCT
GCTCTTTGTTTTGACCCTAGTGGAACTCTGTTGGTCACAGCCTCCGTTCATGGCCATAAC
ATAAATGTTTTCAGGATCATGCCAACCGTAATAGCTAACAGCTCAGGCTCTATACGCTAT
GATTGGACAGCATCTCATGTCCACCTTTACAAACTGTATCGTGGCATGACAGCAGCTGTC
ATCCAGGATATCTCTTTTAGCCATTTTAGCCAGTGGATATCTATTGTTTCATCCCGAGGT
ACTTGCCATATTTTTACATTGTCTCCTTTTGGCGGTGATGCGAGTCTGCTGCCACAGAAT
TCTCACAGTGATGGGCTACCCCTTGCCCCATGTCAATCAAGGCCATGGTGGTCAAAGCCA
TCATTCCTTATGGATCATCAGCTTCATCCAGCTCCTTCAACTGTAACTAATTCTGTAGTC
AGTAGGATAAAAAACAGTTCTTCTGGTTGGCTAAATACTGTTAGTAATGTGGCTGCTTCT
GCAAGTGGGAAACTATCTGTACCATCTGGCGCTGTTACTGCTGTTTTCCACAATTCCAAC
TATGAAGGTTCATTGCCAGTTCCATCAAAGGCTAATGCCATGGAGCATCTATTGGTGTAT
TCACCATCTGGCCATGTTATTCAACATGAACTACTGCCTTCAGGTTCTGAATCCTCTGAT
AGCAGTCCAATAGTTGGGCCTGGTTCCTTGCAGATCCAAGATGATGAGTTGCATGTTACT
GCTGAACCGACTCAGTGGTGGGATGTATGCCGTAGGACAAACTGGCCAGAAAGGGACGAA
AACATTGCAAACATAGTCTTCCATAATCAACGAAATAGTATGATGGCAATGGATGCTTCT
GACTGTGATAGTGAGCATTCAGATTCCGTTCCATCAGATGGTATTTCTGGGAAAGAGATG
ATGAGATCTCGAGAAAGATCAAGTTGGTACCTCTCAAATGCAGAGGTACAGATAAGTTCA
TGGAGGATTCCCATTTGGCAGAAATCAAAGATTTTCTTCTATGTGATAGATCAACCACCT
GCAAAATCAGGGGAATCTCTTAGCTCTAGTGGGGGAGAGATTGAGATTGAGAAGCTGCCT
CTGCATGAGGTTGAACTTCGGAGGAGGGAATTGCTCCCTGTATTCAAGCAGTTCCACTAT
TCTGAACAGAACTTCAGTGACAGATTCAGGAATCTTGCAATAGGACGGTTTCAGAATGCA
TTGACATACATCGACAAGGATAATGGTGCTCATGGATCCAAGGCGGGGTTCCCTATATCT
GGATTTTACAGTGATATGAGGAAAATGCAGAACATGAATGGTTTAGAGGGGCAGTTATTG
TTGGAACCTATCACTAATGATTTACAACCAATGGAAAAATGCAATTCTGTTCAATCTCCT
AAAGTGGCAAATTTTACTGCCCTTCACAATGTAGATAATGAGAGCATGAACCATGTTTCA
ACAGCAACTGGAGCAACCACATCAGTCACAACAGTGGACACTTTACCTTCAACCATCAGA
CCATTGAGCAGCTACTCCCTCTTGGATGGATCTCTTGATGATGGATTACCATCACCTGCA
AGTAATGTATCATTCAGGCCTCAGATAACCAACAATTCTTCAGTAAGCAATGGTACAATG
ACTGACATCTCAAATGGGTGTCTCACGAGCATCAATTCTGGACAGAATGAAGCATCTGAT
TCTCACAACTCAGTGGAGTTTACCCAGTATTTCCAAGAGGGCTATTGTAAAATATCAGAA
CTCGATGACTGCCGTGAGTTAACTGAAGCTGTTACTGATGCTGACAGCAGCAGCAGCCAC
TGCGAGAGAGAGAAGCCCGAGGAAGATGGGGATAACGATGACATGCTTGGGGCTGTTTTT
GCCTTCAGCGAAGAAGGTTGA

Protein

1006 aa

>Os05t0405900-01 WD40 repeat-like domain containing protein.
MRRGKGGRNGLLPSSLRIISSCLKTVSSNAGSVASTVRSAGASVAASIAPQAEDEKDQVL
WAGFDKLELHPSSFKHVLLVGYSNGFQVLDVEDAANVCELVSKRDGPVTFLQMQPTPVYS
DGTEGFRTSHPMLLVVAGDETNGSGMVQGGRLSALIRDNSSETPNGNCISTPTVVRFYSL
KSHSYVHVLRFRSAVYIVRCSPRIVAVALAAQVYCFDAVTLENKFSVLTYPLQGAPGINI
GYGPMAVGPRWLAYASNSPLLSSTGRLSPQNLTPSPGVSPSTSPSSGSLVARYAMESSKQ
IAAGIINLGDMGYKTLSKYCQEFLPDGSGSPLSSSPGRRSGKLPSSVHPLEADNAGMVVI
KDFISKEIISQFRAHTSPISALCFDPSGTLLVTASVHGHNINVFRIMPTVIANSSGSIRY
DWTASHVHLYKLYRGMTAAVIQDISFSHFSQWISIVSSRGTCHIFTLSPFGGDASLLPQN
SHSDGLPLAPCQSRPWWSKPSFLMDHQLHPAPSTVTNSVVSRIKNSSSGWLNTVSNVAAS
ASGKLSVPSGAVTAVFHNSNYEGSLPVPSKANAMEHLLVYSPSGHVIQHELLPSGSESSD
SSPIVGPGSLQIQDDELHVTAEPTQWWDVCRRTNWPERDENIANIVFHNQRNSMMAMDAS
DCDSEHSDSVPSDGISGKEMMRSRERSSWYLSNAEVQISSWRIPIWQKSKIFFYVIDQPP
AKSGESLSSSGGEIEIEKLPLHEVELRRRELLPVFKQFHYSEQNFSDRFRNLAIGRFQNA
LTYIDKDNGAHGSKAGFPISGFYSDMRKMQNMNGLEGQLLLEPITNDLQPMEKCNSVQSP
KVANFTALHNVDNESMNHVSTATGATTSVTTVDTLPSTIRPLSSYSLLDGSLDDGLPSPA
SNVSFRPQITNNSSVSNGTMTDISNGCLTSINSGQNEASDSHNSVEFTQYFQEGYCKISE
LDDCRELTEAVTDADSSSSHCEREKPEEDGDNDDMLGAVFAFSEEG*

5'UTR

chr05:19768783..19769142 (+ strand) : 360 bp

CDS

chr05:19769143..19769316 (+ strand) : 174 bp

chr05:19770154..19770615 (+ strand) : 462 bp

chr05:19770716..19771150 (+ strand) : 435 bp

chr05:19771237..19771482 (+ strand) : 246 bp

chr05:19771563..19772375 (+ strand) : 813 bp

chr05:19772490..19772662 (+ strand) : 173 bp

chr05:19773576..19773685 (+ strand) : 110 bp

chr05:19773770..19774372 (+ strand) : 603 bp

chr05:19774455..19774459 (+ strand) : 5 bp

3'UTR

chr05:19774460..19775018 (+ strand) : 559 bp

FASTA

>Os05t0405900-01 class=Sequence position=chr05:19768783..19775018 (+ strand)
AGGCACACGA AAGCAACAGC GAGGAGGGGA GAGAGAGAGA GAGAGAGAGA GAGAGGAAAA GGGAGAAGCC AAGGAGTTGT
TGGTTCTGGT CGGAGTCGGA GGAGGAGGAG GAGGAGGAGG GAGATGGTGG CGAGCTGACT TGGCGGATCG CGGCGGCGGC
GGCGGGGGAT CGGAGGGGGA GCAGGGCCAC TCGGATGGTA TTGGGCTTCG CCGGCGCCGG AGGCGGCGAT CGCGGATGGG
CGGCGGGCGG GGCGGGGGCC GGGGGTTGTA GGTGGAGGAG GAGGAGGGGC GGTTCCGGAG TTTGGGGAGG GGGCGGCGGT
GCTCGTGCTG GGGGAGGAGT GGGGAGGAGG AGGAGGAGGG ATGAGGCGCG GGAAGGGCGG GAGGAACGGG CTGCTGCCGA
GCTCGCTGAG GATCATCTCG TCGTGCCTCA AGACGGTGTC GTCCAACGCC GGCTCCGTCG CGTCCACGGT GCGCTCGGCC
GGCGCCTCCG TCGCCGCCTC CATCGCCCCC CAGGCCGAGG ACGAGAAGGA CCAGGTCCGC TCCTCCCACA CGCTACTGCC
CTCCCCGCCC CTCCCAACTA TTCAAATATA TGTTGGTTTT CTCACTATTG AAGCTAGCTG TGGGAGTAGC TAAGTTTAGT
CCTGATGTAA TATGGTTGCA ATCGTGGACT TCAATCACGG CATTTTGCGG TAGTACGTTG TGATTTAGTC CCGCGTGGTA
GATCTTATGT TCTTGTAGAT TCAAAATTCT GTGCGCAAGT AGTACATTTG GAGGAGGCCA GTTGACTACC ATAAAGCTAA
AATGGATATA CAGAATTGGT AAATCTACAA CATGCGGGAG TTGAATGGGT ACTCTTATCC AATTCAACAA TGGTTGAAAT
TCTAGTTATC TACATGGTGG GCAAAACAAT ATTTTTCAAG TAAAGCAAGA ACCAAAAAAC AATTGGTCTG TTCCATAACT
CAAAATTTTC TTTCTTTGCC ACGGTTTCAC TATTGTAACT ATATCTCAAC TTTGTTGGGA GCCTGGAAGC TGACTTTCTG
CTTTATTACA TCATACTTTT CTGATGTGTG TTTTTGAGAC CAATTAGTAA ATAGTGCTTT TGTTATTTTG GTTCAGTTCT
CATTGTGCTA TGCTTCCATT TAGTAAATAG ACCAATTTAG TTTTCCGTGT GCTATGCTTC CATTTTGGAA TGTATTCATC
AGAAGAGCAT TTTCTTTTTT CTGTTGACCG GTTAGTGGTA TTGTTTGTGC AACCAATTTA ATTTTCACTA ACCATTTACT
TCTGTTCTTT AAACCAATGT GTACATGTAG CTCTAGTATA TTATGCAAAT TTGAACATAA CCGTAGTCTT GATGCTTCAT
TATATAAACA GGTATTGTGG GCTGGATTTG ATAAATTAGA GCTTCATCCA TCATCTTTCA AGCATGTTTT GCTTGTTGGT
TATTCAAATG GGTTCCAAGT GCTTGATGTT GAGGATGCTG CAAATGTTTG CGAATTGGTC TCAAAACGTG ATGGTCCAGT
TACATTTTTA CAAATGCAAC CCACACCAGT TTACTCTGAT GGTACTGAAG GATTCAGAAC ATCACATCCC ATGCTTCTGG
TTGTTGCCGG TGATGAGACA AATGGGTCGG GTATGGTTCA AGGTGGTCGC TTAAGTGCAC TGATCAGAGA TAATAGCAGT
GAAACTCCAA ATGGAAATTG CATTTCTACT CCAACAGTTG TTCGCTTCTA CTCTTTGAAG TCTCACTCAT ATGTACATGT
TCTGAGATTT CGGTCTGCCG TATATATAGT TCGCTGCAGC CCCCGGATTG TAGCTGTAGC TCTTGCAGCA CAAGTAAGTT
TCTCTTGGTG CTCTTATTTA TTGTTAAATG ACATAGAGGA GTACATGCTT TTAATTTACT TCGGTGTACT TATATGTTTT
AACTACATTC CAGGTATACT GCTTTGATGC TGTGACCCTT GAGAATAAGT TCAGTGTCTT GACATATCCT TTGCAAGGGG
CACCTGGGAT AAATATTGGG TATGGCCCAA TGGCTGTTGG CCCAAGGTGG TTAGCTTATG CTTCCAATAG CCCTTTATTA
TCAAGCACAG GCCGTCTAAG TCCACAGAAC CTTACACCAT CTCCAGGAGT TAGCCCATCT ACCTCCCCTA GTAGTGGAAG
TTTAGTTGCT CGGTATGCAA TGGAATCAAG TAAGCAGATA GCTGCTGGTA TTATTAATCT TGGTGATATG GGATACAAGA
CACTGTCAAA GTACTGCCAA GAATTTCTGC CAGATGGTTC TGGCTCCCCC TTGTCATCAA GTCCTGGCAG AAGATCTGGC
AAACTTCCCT CTAGCGTGCA TCCGCTGGAA GCTGACAATG CTGGAATGGT TAGTTGAGGC TTGAGCAAGC CTTCACTTTG
TCACATGCTC ACATTTCTGT TTCCTAATAG TGTAATCCTC TTGAACTCTT GCAGGTTGTC ATCAAGGATT TTATCTCGAA
AGAAATCATA TCTCAGTTTA GGGCTCACAC AAGTCCCATA TCTGCTCTTT GTTTTGACCC TAGTGGAACT CTGTTGGTCA
CAGCCTCCGT TCATGGCCAT AACATAAATG TTTTCAGGAT CATGCCAACC GTAATAGCTA ACAGCTCAGG CTCTATACGC
TATGATTGGA CAGCATCTCA TGTCCACCTT TACAAACTGT ATCGTGGCAT GACAGCAGCT GTATGTTCAA AAGAAAATAA
AAGTTCAATT TAAACTTGTT ATCTTGGGTT TATTTCTGAT TATATTGCAT CTGCTTGCAG GTCATCCAGG ATATCTCTTT
TAGCCATTTT AGCCAGTGGA TATCTATTGT TTCATCCCGA GGTACTTGCC ATATTTTTAC ATTGTCTCCT TTTGGCGGTG
ATGCGAGTCT GCTGCCACAG AATTCTCACA GTGATGGGCT ACCCCTTGCC CCATGTCAAT CAAGGCCATG GTGGTCAAAG
CCATCATTCC TTATGGATCA TCAGCTTCAT CCAGCTCCTT CAACTGTAAC TAATTCTGTA GTCAGTAGGA TAAAAAACAG
TTCTTCTGGT TGGCTAAATA CTGTTAGTAA TGTGGCTGCT TCTGCAAGTG GGAAACTATC TGTACCATCT GGCGCTGTTA
CTGCTGTTTT CCACAATTCC AACTATGAAG GTTCATTGCC AGTTCCATCA AAGGCTAATG CCATGGAGCA TCTATTGGTG
TATTCACCAT CTGGCCATGT TATTCAACAT GAACTACTGC CTTCAGGTTC TGAATCCTCT GATAGCAGTC CAATAGTTGG
GCCTGGTTCC TTGCAGATCC AAGATGATGA GTTGCATGTT ACTGCTGAAC CGACTCAGTG GTGGGATGTA TGCCGTAGGA
CAAACTGGCC AGAAAGGGAC GAAAACATTG CAAACATAGT CTTCCATAAT CAACGAAATA GTATGATGGC AATGGATGCT
TCTGACTGTG ATAGTGAGCA TTCAGATTCC GTTCCATCAG ATGGTATTTC TGGGAAAGAG ATGATGAGAT CTCGAGAAAG
ATCAAGTTGG TACCTCTCAA ATGCAGAGGT ACAGATAAGT TCATGGAGGA TTCCCATTTG GCAGAAATCA AAGGTTGTGC
CTCCTTGTCT CAACATTGTG CTCAGCTTCT TTCTTCTTCT TTTTTGAGAT AACGTTGTGC TCAGTTGTGT GCAATGAATA
TTGAATATTG TTTTCATGTT TGTGTAGATT TTCTTCTATG TGATAGATCA ACCACCTGCA AAATCAGGGG AATCTCTTAG
CTCTAGTGGG GGAGAGATTG AGATTGAGAA GCTGCCTCTG CATGAGGTTG AACTTCGGAG GAGGGAATTG CTCCCTGTAT
TCAAGCAGTT CCACTATTCT GAACAGAACT TCAGTGACAG GTAATGTCAG CAAATTTTGG CTGGTAAATT TTTGTTTCTT
TTATCTGTAG TAAAGATATG CTTTCAATGC CATTCATTTT AGATAATATT TTCCCCAAAA CAGAAGCTGG TTAAGTCAGC
TTAAAATCTA AATTATATGG CATTTCCCAT TCTGGACTGG TTTAACTGAA CACTGGCAGT AACAGACAGG TTTCTGAATC
TGGATGGTCT AATGTGTATT TTATAGTTTG GGTACATCAT TGTCTCAGGT GCATGGTGTG CATGGACTAA TTCTGCAAAT
GTCAAATTTC AAAAAGTATA TGGACTAAGG TTGATGATTG TTATGCAGAC TTGGCTAAAT CTAGTCTGGA TTTGCCACAC
TTTCTGGCAA AGATTTCTTT TTGGCCACAT TATGGTGGCT GCTACATGTT GAAAAGTTGT CATTCTTGTG AGTTGTTTTG
AGGGAACAGA TTTACATGAT CCTAAGTAGT TGCCGAAATA ATGCGAGAGT GGATCTATCT GGGGATTGCG TATATTGTAA
TAAACTTCTG GTAGGAAATG GATAGACTTC TTGCGGGCAA TGTGAATGTA TAAAATTTTT GAAAACGAGA GAATTTCAGT
ATCACATAAT TTTAAGATTC CAATTAATTG TCATTTGTGT GTAGAAGTAA AATAGAAGGT GGTATGATAC TAGCTAGTAG
TATTGCAATT AATTGAGCCT TTTTTAACCT TGGTTTGGTA GTTTGGTACC ATATACATCG GTGTTATTAC ATGTTTTTTT
GAAGTAGCAG ATGCTAGTGC CTATACTTGA TTATTTTAGA ATTGAGCTGT CCAATATTTT GATAGTTTTC TTTTAGTGCA
AATGAACCAA TGCATGTCTA ATTATGATTT TTAATGTGAC TTCATTCAAA TGCGAAGTTA ACAATATTCA AAGATTCAGG
AATCTTGCAA TAGGACGGTT TCAGAATGCA TTGACATACA TCGACAAGGA TAATGGTGCT CATGGATCCA AGGCGGGGTT
CCCTATATCT GGATTTTACA GTGGTAAGCA TATGAGCGTA TGATGTCATT TGTAATACTT CATCCCAGTT ATGTGTCATA
GTTAATTGAA AAGCCTTTCT TTTGCAGATA TGAGGAAAAT GCAGAACATG AATGGTTTAG AGGGGCAGTT ATTGTTGGAA
CCTATCACTA ATGATTTACA ACCAATGGAA AAATGCAATT CTGTTCAATC TCCTAAAGTG GCAAATTTTA CTGCCCTTCA
CAATGTAGAT AATGAGAGCA TGAACCATGT TTCAACAGCA ACTGGAGCAA CCACATCAGT CACAACAGTG GACACTTTAC
CTTCAACCAT CAGACCATTG AGCAGCTACT CCCTCTTGGA TGGATCTCTT GATGATGGAT TACCATCACC TGCAAGTAAT
GTATCATTCA GGCCTCAGAT AACCAACAAT TCTTCAGTAA GCAATGGTAC AATGACTGAC ATCTCAAATG GGTGTCTCAC
GAGCATCAAT TCTGGACAGA ATGAAGCATC TGATTCTCAC AACTCAGTGG AGTTTACCCA GTATTTCCAA GAGGGCTATT
GTAAAATATC AGAACTCGAT GACTGCCGTG AGTTAACTGA AGCTGTTACT GATGCTGACA GCAGCAGCAG CCACTGCGAG
AGAGAGAAGC CCGAGGAAGA TGGGGATAAC GATGACATGC TTGGGGCTGT TTTTGCCTTC AGCGAAGAAG GTACTGTCTG
TGATGCAAGT TCTATGAGGG CGTTGCATAT TTTTGCGTTG TGCTGACCTA TCTCTCTTCT TTCTGGTGGC AGGTTGAACC
TAATAATATA CTCTGCTTTT ACATAGAGAA TGGAAAACAG TGCCCGTGAT ATTACCTAGA AAATGGTGGA TTTCCATTAG
GCTTTCGTGG AATAAATTGG TGCTGAGATG ATAATCTACT ATTTGGTACA TATTAGAAAG GTGAAGCTTG TGCTCGATAT
CCATTTGTGA GAAGTTTTAC TCAGGAATTG AGATCAAGAT CCTTCCTTCC GGGCCATTAA CTAATCCACG GATCCACGTT
AAGGGGAGCT TGGTGTTGTC GAGAAGTTGC TGCTGCCTGC CGCAACACTG CCCCTTTTCC GTTGCTTTGT ACATACTGTA
AAAGACCATT TGTTTTGTGA AATACGTCTC TGGAACATTG GACGGTCCAA CTTCCTTGGC AGCCATATTT GTTGACTGCT
TCCTGCCAAG GCCTGTTAAT GTTCCTTGTT TATTTGTACA GTCTTTTCTG TTTCATTAAG GAAAAAGAAA ATCTAGCAAG
GATTAATGTG ACATAACTGT ATAAACATTC AGTAAAGAAT TTCCGTTTAC GAAGAAATGT TAATTGTTTC CCTTGC

Locus: Os05g0405900

Loading...

Locus: Os05g0405900

Loading...