Os05t0405900-02

Locus

Os05g0405900

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG18F

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 18F

Oryzabase Gene Symbol Synonym(s)

OsATG18f, OsWD40-118

Oryzabase Gene Name Synonym(s)

autophagy 18f

Transcript Evidence

AK099795 (DDBJ, Best hit)

Protein Evidence

B9FPJ6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

WD40 repeat (IPR001680)

WD40 repeat-like-containing domain (IPR011046)

WD40/YVTN repeat-like-containing domain (IPR015943)

WD40 repeat, subgroup (IPR019781)

Breast carcinoma amplified sequence 3 (IPR022175)

Full-length cDNA

J013097F10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0405900-02)

RiceXPro (AK099795)

Others

Oryzabase (9665)

KEGG (Os05t0405900-02)

Transcript

2534 bp

>Os05t0405900-02 Hypothetical conserved gene.
CTGGCAAACTTCCCTCTAGCGTGCATCCGCTGGAAGCTGACAATGCTGGAATGGTTGTCA
TCAAGGATTTTATCTCGAAAGAAATCATATCTCAGTTTAGGGCTCACACAAGTCCCATAT
CTGCTCTTTGTTTTGACCCTAGTGGAACTCTGTTGGTCACAGCCTCCGTTCATGGCCATA
ACATAAATGTTTTCAGGATCATGCCAACCGTAATAGCTAACAGCTCAGGCTCTATACGCT
ATGATTGGACAGCATCTCATGTCCACCTTTACAAACTGTATCGTGGCATGACAGCAGCTG
TCATCCAGGATATCTCTTTTAGCCATTTTAGCCAGTGGATATCTATTGTTTCATCCCGAG
GTACTTGCCATATTTTTACATTGTCTCCTTTTGGCGGTGATGCGAGTCTGCTGCCACAGA
ATTCTCACAGTGATGGGCTACCCCTTGCCCCATGTCAATCAAGGCCATGGTGGTCAAAGC
CATCATTCCTTATGGATCATCAGCTTCATCCAGCTCCTTCAACTGTAACTAATTCTGTAG
TCAGTAGGATAAAAAACAGTTCTTCTGGTTGGCTAAATACTGTTAGTAATGTGGCTGCTT
CTGCAAGTGGGAAACTATCTGTACCATCTGGCGCTGTTACTGCTGTTTTCCACAATTCCA
ACTATGAAGGTTCATTGCCAGTTCCATCAAAGGCTAATGCCATGGAGCATCTATTGGTGT
ATTCACCATCTGGCCATGTTATTCAACATGAACTACTGCCTTCAGGTTCTGAATCCTCTG
ATAGCAGTCCAATAGTTGGGCCTGGTTCCTTGCAGATCCAAGATGATGAGTTGCATGTTA
CTGCTGAACCGACTCAGTGGTGGGATGTATGCCGTAGGACAAACTGGCCAGAAAGGGACG
AAAACATTGCAAACATAGTCTTCCATAATCAACGAAATAGTATGATGGCAATGGATGCTT
CTGACTGTGATAGTGAGCATTCAGATTCCGTTCCATCAGATGGTATTTCTGGGAAAGAGA
TGATGAGATCTCGAGAAAGATCAAGTTGGTACCTCTCAAATGCAGAGGTACAGATAAGTT
CATGGAGGATTCCCATTTGGCAGAAATCAAAGATTTTCTTCTATGTGATAGATCAACCAC
CTGCAAAATCAGGGGAATCTCTTAGCTCTAGTGGGGGAGAGATTGAGATTGAGAAGCTGC
CTCTGCATGAGGTTGAACTTCGGAGGAGGGAATTGCTCCCTGTATTCAAGCAGTTCCACT
ATTCTGAACAGAACTTCAGTGACAGGAATCTTGCAATAGGACGGTTTCAGAATGCATTGA
CATACATCGACAAGGATAATGGTGCTCATGGATCCAAGGCGGGGTTCCCTATATCTGGAT
TTTACAGTGATATGAGGAAAATGCAGAACATGAATGGTTTAGAGGGGCAGTTATTGTTGG
AACCTATCACTAATGATTTACAACCAATGGAAAAATGCAATTCTGTTCAATCTCCTAAAG
TGGCAAATTTTACTGCCCTTCACAATGTAGATAATGAGAGCATGAACCATGTTTCAACAG
CAACTGGAGCAACCACATCAGTCACAACAGTGGACACTTTACCTTCAACCATCAGACCAT
TGAGCAGCTACTCCCTCTTGGATGGATCTCTTGATGATGGATTACCATCACCTGCAAGTA
ATGTATCATTCAGGCCTCAGATAACCAACAATTCTTCAGTAAGCAATGGTACAATGACTG
ACATCTCAAATGGGTGTCTCACGAGCATCAATTCTGGACAGAATGAAGCATCTGATTCTC
ACAACTCAGTGGAGTTTACCCAGTATTTCCAAGAGGGCTATTGTAAAATATCAGAACTCG
ATGACTGCCGTGAGTTAACTGAAGCTGTTACTGATGCTGACAGCAGCAGCAGCCACTGCG
AGAGAGAGAAGCCCGAGGAAGATGGGGATAACGATGACATGCTTGGGGCTGTTTTTGCCT
TCAGCGAAGAAGGTTGAACCTAATAATATACTCTGCTTTTACATAGAGAATGGAAAACAG
TGCCCGTGATATTACCTAGAAAATGGTGGATTTCCATTAGGCTTTCGTGGAATAAATTGG
TGCTGAGATGATAATCTACTATTTGGTACATATTAGAAAGGTGAAGCTTGTGCTCGATAT
CCATTTGTGAGAAGTTTTACTCAGGAATTGAGATCAAGATCCTTCCTTCCGGGCCATTAA
CTAATCCACGGATCCACGTTAAGGGGAGCTTGGTGTTGTCGAGAAGTTGCTGCTGCCTGC
CGCAACACTGCCCCTTTTCCGTTGCTTTGTACATACTGTAAAAGACCATTTGTTTTGTGA
AATACGTCTCTGGAACATTGGACGGTCCAACTTCCTTGGCAGCCATATTTGTTGACTGCT
TCCTGCCAAGGCCTGTTAATGTTCCTTGTTTATTTGTACAGTCTTTTCTGTTTCATTAAG
GAAAAAGAAAATCTAGCAAGGATTAATGTGACATAACTGTATAAACATTCAGTAAAGAAT
TTCCGTTTACGAAG

CDS

1995 bp

>Os05t0405900-02 Hypothetical conserved gene.
GGCAAACTTCCCTCTAGCGTGCATCCGCTGGAAGCTGACAATGCTGGAATGGTTGTCATC
AAGGATTTTATCTCGAAAGAAATCATATCTCAGTTTAGGGCTCACACAAGTCCCATATCT
GCTCTTTGTTTTGACCCTAGTGGAACTCTGTTGGTCACAGCCTCCGTTCATGGCCATAAC
ATAAATGTTTTCAGGATCATGCCAACCGTAATAGCTAACAGCTCAGGCTCTATACGCTAT
GATTGGACAGCATCTCATGTCCACCTTTACAAACTGTATCGTGGCATGACAGCAGCTGTC
ATCCAGGATATCTCTTTTAGCCATTTTAGCCAGTGGATATCTATTGTTTCATCCCGAGGT
ACTTGCCATATTTTTACATTGTCTCCTTTTGGCGGTGATGCGAGTCTGCTGCCACAGAAT
TCTCACAGTGATGGGCTACCCCTTGCCCCATGTCAATCAAGGCCATGGTGGTCAAAGCCA
TCATTCCTTATGGATCATCAGCTTCATCCAGCTCCTTCAACTGTAACTAATTCTGTAGTC
AGTAGGATAAAAAACAGTTCTTCTGGTTGGCTAAATACTGTTAGTAATGTGGCTGCTTCT
GCAAGTGGGAAACTATCTGTACCATCTGGCGCTGTTACTGCTGTTTTCCACAATTCCAAC
TATGAAGGTTCATTGCCAGTTCCATCAAAGGCTAATGCCATGGAGCATCTATTGGTGTAT
TCACCATCTGGCCATGTTATTCAACATGAACTACTGCCTTCAGGTTCTGAATCCTCTGAT
AGCAGTCCAATAGTTGGGCCTGGTTCCTTGCAGATCCAAGATGATGAGTTGCATGTTACT
GCTGAACCGACTCAGTGGTGGGATGTATGCCGTAGGACAAACTGGCCAGAAAGGGACGAA
AACATTGCAAACATAGTCTTCCATAATCAACGAAATAGTATGATGGCAATGGATGCTTCT
GACTGTGATAGTGAGCATTCAGATTCCGTTCCATCAGATGGTATTTCTGGGAAAGAGATG
ATGAGATCTCGAGAAAGATCAAGTTGGTACCTCTCAAATGCAGAGGTACAGATAAGTTCA
TGGAGGATTCCCATTTGGCAGAAATCAAAGATTTTCTTCTATGTGATAGATCAACCACCT
GCAAAATCAGGGGAATCTCTTAGCTCTAGTGGGGGAGAGATTGAGATTGAGAAGCTGCCT
CTGCATGAGGTTGAACTTCGGAGGAGGGAATTGCTCCCTGTATTCAAGCAGTTCCACTAT
TCTGAACAGAACTTCAGTGACAGGAATCTTGCAATAGGACGGTTTCAGAATGCATTGACA
TACATCGACAAGGATAATGGTGCTCATGGATCCAAGGCGGGGTTCCCTATATCTGGATTT
TACAGTGATATGAGGAAAATGCAGAACATGAATGGTTTAGAGGGGCAGTTATTGTTGGAA
CCTATCACTAATGATTTACAACCAATGGAAAAATGCAATTCTGTTCAATCTCCTAAAGTG
GCAAATTTTACTGCCCTTCACAATGTAGATAATGAGAGCATGAACCATGTTTCAACAGCA
ACTGGAGCAACCACATCAGTCACAACAGTGGACACTTTACCTTCAACCATCAGACCATTG
AGCAGCTACTCCCTCTTGGATGGATCTCTTGATGATGGATTACCATCACCTGCAAGTAAT
GTATCATTCAGGCCTCAGATAACCAACAATTCTTCAGTAAGCAATGGTACAATGACTGAC
ATCTCAAATGGGTGTCTCACGAGCATCAATTCTGGACAGAATGAAGCATCTGATTCTCAC
AACTCAGTGGAGTTTACCCAGTATTTCCAAGAGGGCTATTGTAAAATATCAGAACTCGAT
GACTGCCGTGAGTTAACTGAAGCTGTTACTGATGCTGACAGCAGCAGCAGCCACTGCGAG
AGAGAGAAGCCCGAGGAAGATGGGGATAACGATGACATGCTTGGGGCTGTTTTTGCCTTC
AGCGAAGAAGGTTGA

Protein

664 aa

>Os05t0405900-02 Hypothetical conserved gene.
GKLPSSVHPLEADNAGMVVIKDFISKEIISQFRAHTSPISALCFDPSGTLLVTASVHGHN
INVFRIMPTVIANSSGSIRYDWTASHVHLYKLYRGMTAAVIQDISFSHFSQWISIVSSRG
TCHIFTLSPFGGDASLLPQNSHSDGLPLAPCQSRPWWSKPSFLMDHQLHPAPSTVTNSVV
SRIKNSSSGWLNTVSNVAASASGKLSVPSGAVTAVFHNSNYEGSLPVPSKANAMEHLLVY
SPSGHVIQHELLPSGSESSDSSPIVGPGSLQIQDDELHVTAEPTQWWDVCRRTNWPERDE
NIANIVFHNQRNSMMAMDASDCDSEHSDSVPSDGISGKEMMRSRERSSWYLSNAEVQISS
WRIPIWQKSKIFFYVIDQPPAKSGESLSSSGGEIEIEKLPLHEVELRRRELLPVFKQFHY
SEQNFSDRNLAIGRFQNALTYIDKDNGAHGSKAGFPISGFYSDMRKMQNMNGLEGQLLLE
PITNDLQPMEKCNSVQSPKVANFTALHNVDNESMNHVSTATGATTSVTTVDTLPSTIRPL
SSYSLLDGSLDDGLPSPASNVSFRPQITNNSSVSNGTMTDISNGCLTSINSGQNEASDSH
NSVEFTQYFQEGYCKISELDDCRELTEAVTDADSSSSHCEREKPEEDGDNDDMLGAVFAF
SEEG*

5'UTR

chr05:19771098..19771099 (+ strand) : 2 bp

CDS

chr05:19771100..19771150 (+ strand) : 51 bp

chr05:19771237..19771482 (+ strand) : 246 bp

chr05:19771563..19772375 (+ strand) : 813 bp

chr05:19772490..19772662 (+ strand) : 173 bp

chr05:19773582..19773685 (+ strand) : 104 bp

chr05:19773770..19774372 (+ strand) : 603 bp

chr05:19774455..19774459 (+ strand) : 5 bp

3'UTR

chr05:19774460..19774996 (+ strand) : 537 bp

FASTA

>Os05t0405900-02 class=Sequence position=chr05:19771098..19774996 (+ strand)
CTGGCAAACT TCCCTCTAGC GTGCATCCGC TGGAAGCTGA CAATGCTGGA ATGGTTAGTT GAGGCTTGAG CAAGCCTTCA
CTTTGTCACA TGCTCACATT TCTGTTTCCT AATAGTGTAA TCCTCTTGAA CTCTTGCAGG TTGTCATCAA GGATTTTATC
TCGAAAGAAA TCATATCTCA GTTTAGGGCT CACACAAGTC CCATATCTGC TCTTTGTTTT GACCCTAGTG GAACTCTGTT
GGTCACAGCC TCCGTTCATG GCCATAACAT AAATGTTTTC AGGATCATGC CAACCGTAAT AGCTAACAGC TCAGGCTCTA
TACGCTATGA TTGGACAGCA TCTCATGTCC ACCTTTACAA ACTGTATCGT GGCATGACAG CAGCTGTATG TTCAAAAGAA
AATAAAAGTT CAATTTAAAC TTGTTATCTT GGGTTTATTT CTGATTATAT TGCATCTGCT TGCAGGTCAT CCAGGATATC
TCTTTTAGCC ATTTTAGCCA GTGGATATCT ATTGTTTCAT CCCGAGGTAC TTGCCATATT TTTACATTGT CTCCTTTTGG
CGGTGATGCG AGTCTGCTGC CACAGAATTC TCACAGTGAT GGGCTACCCC TTGCCCCATG TCAATCAAGG CCATGGTGGT
CAAAGCCATC ATTCCTTATG GATCATCAGC TTCATCCAGC TCCTTCAACT GTAACTAATT CTGTAGTCAG TAGGATAAAA
AACAGTTCTT CTGGTTGGCT AAATACTGTT AGTAATGTGG CTGCTTCTGC AAGTGGGAAA CTATCTGTAC CATCTGGCGC
TGTTACTGCT GTTTTCCACA ATTCCAACTA TGAAGGTTCA TTGCCAGTTC CATCAAAGGC TAATGCCATG GAGCATCTAT
TGGTGTATTC ACCATCTGGC CATGTTATTC AACATGAACT ACTGCCTTCA GGTTCTGAAT CCTCTGATAG CAGTCCAATA
GTTGGGCCTG GTTCCTTGCA GATCCAAGAT GATGAGTTGC ATGTTACTGC TGAACCGACT CAGTGGTGGG ATGTATGCCG
TAGGACAAAC TGGCCAGAAA GGGACGAAAA CATTGCAAAC ATAGTCTTCC ATAATCAACG AAATAGTATG ATGGCAATGG
ATGCTTCTGA CTGTGATAGT GAGCATTCAG ATTCCGTTCC ATCAGATGGT ATTTCTGGGA AAGAGATGAT GAGATCTCGA
GAAAGATCAA GTTGGTACCT CTCAAATGCA GAGGTACAGA TAAGTTCATG GAGGATTCCC ATTTGGCAGA AATCAAAGGT
TGTGCCTCCT TGTCTCAACA TTGTGCTCAG CTTCTTTCTT CTTCTTTTTT GAGATAACGT TGTGCTCAGT TGTGTGCAAT
GAATATTGAA TATTGTTTTC ATGTTTGTGT AGATTTTCTT CTATGTGATA GATCAACCAC CTGCAAAATC AGGGGAATCT
CTTAGCTCTA GTGGGGGAGA GATTGAGATT GAGAAGCTGC CTCTGCATGA GGTTGAACTT CGGAGGAGGG AATTGCTCCC
TGTATTCAAG CAGTTCCACT ATTCTGAACA GAACTTCAGT GACAGGTAAT GTCAGCAAAT TTTGGCTGGT AAATTTTTGT
TTCTTTTATC TGTAGTAAAG ATATGCTTTC AATGCCATTC ATTTTAGATA ATATTTTCCC CAAAACAGAA GCTGGTTAAG
TCAGCTTAAA ATCTAAATTA TATGGCATTT CCCATTCTGG ACTGGTTTAA CTGAACACTG GCAGTAACAG ACAGGTTTCT
GAATCTGGAT GGTCTAATGT GTATTTTATA GTTTGGGTAC ATCATTGTCT CAGGTGCATG GTGTGCATGG ACTAATTCTG
CAAATGTCAA ATTTCAAAAA GTATATGGAC TAAGGTTGAT GATTGTTATG CAGACTTGGC TAAATCTAGT CTGGATTTGC
CACACTTTCT GGCAAAGATT TCTTTTTGGC CACATTATGG TGGCTGCTAC ATGTTGAAAA GTTGTCATTC TTGTGAGTTG
TTTTGAGGGA ACAGATTTAC ATGATCCTAA GTAGTTGCCG AAATAATGCG AGAGTGGATC TATCTGGGGA TTGCGTATAT
TGTAATAAAC TTCTGGTAGG AAATGGATAG ACTTCTTGCG GGCAATGTGA ATGTATAAAA TTTTTGAAAA CGAGAGAATT
TCAGTATCAC ATAATTTTAA GATTCCAATT AATTGTCATT TGTGTGTAGA AGTAAAATAG AAGGTGGTAT GATACTAGCT
AGTAGTATTG CAATTAATTG AGCCTTTTTT AACCTTGGTT TGGTAGTTTG GTACCATATA CATCGGTGTT ATTACATGTT
TTTTTGAAGT AGCAGATGCT AGTGCCTATA CTTGATTATT TTAGAATTGA GCTGTCCAAT ATTTTGATAG TTTTCTTTTA
GTGCAAATGA ACCAATGCAT GTCTAATTAT GATTTTTAAT GTGACTTCAT TCAAATGCGA AGTTAACAAT ATTCAAAGAT
TCAGGAATCT TGCAATAGGA CGGTTTCAGA ATGCATTGAC ATACATCGAC AAGGATAATG GTGCTCATGG ATCCAAGGCG
GGGTTCCCTA TATCTGGATT TTACAGTGGT AAGCATATGA GCGTATGATG TCATTTGTAA TACTTCATCC CAGTTATGTG
TCATAGTTAA TTGAAAAGCC TTTCTTTTGC AGATATGAGG AAAATGCAGA ACATGAATGG TTTAGAGGGG CAGTTATTGT
TGGAACCTAT CACTAATGAT TTACAACCAA TGGAAAAATG CAATTCTGTT CAATCTCCTA AAGTGGCAAA TTTTACTGCC
CTTCACAATG TAGATAATGA GAGCATGAAC CATGTTTCAA CAGCAACTGG AGCAACCACA TCAGTCACAA CAGTGGACAC
TTTACCTTCA ACCATCAGAC CATTGAGCAG CTACTCCCTC TTGGATGGAT CTCTTGATGA TGGATTACCA TCACCTGCAA
GTAATGTATC ATTCAGGCCT CAGATAACCA ACAATTCTTC AGTAAGCAAT GGTACAATGA CTGACATCTC AAATGGGTGT
CTCACGAGCA TCAATTCTGG ACAGAATGAA GCATCTGATT CTCACAACTC AGTGGAGTTT ACCCAGTATT TCCAAGAGGG
CTATTGTAAA ATATCAGAAC TCGATGACTG CCGTGAGTTA ACTGAAGCTG TTACTGATGC TGACAGCAGC AGCAGCCACT
GCGAGAGAGA GAAGCCCGAG GAAGATGGGG ATAACGATGA CATGCTTGGG GCTGTTTTTG CCTTCAGCGA AGAAGGTACT
GTCTGTGATG CAAGTTCTAT GAGGGCGTTG CATATTTTTG CGTTGTGCTG ACCTATCTCT CTTCTTTCTG GTGGCAGGTT
GAACCTAATA ATATACTCTG CTTTTACATA GAGAATGGAA AACAGTGCCC GTGATATTAC CTAGAAAATG GTGGATTTCC
ATTAGGCTTT CGTGGAATAA ATTGGTGCTG AGATGATAAT CTACTATTTG GTACATATTA GAAAGGTGAA GCTTGTGCTC
GATATCCATT TGTGAGAAGT TTTACTCAGG AATTGAGATC AAGATCCTTC CTTCCGGGCC ATTAACTAAT CCACGGATCC
ACGTTAAGGG GAGCTTGGTG TTGTCGAGAA GTTGCTGCTG CCTGCCGCAA CACTGCCCCT TTTCCGTTGC TTTGTACATA
CTGTAAAAGA CCATTTGTTT TGTGAAATAC GTCTCTGGAA CATTGGACGG TCCAACTTCC TTGGCAGCCA TATTTGTTGA
CTGCTTCCTG CCAAGGCCTG TTAATGTTCC TTGTTTATTT GTACAGTCTT TTCTGTTTCA TTAAGGAAAA AGAAAATCTA
GCAAGGATTA ATGTGACATA ACTGTATAAA CATTCAGTAA AGAATTTCCG TTTACGAAG

Locus: Os05g0405900

Loading...

Locus: Os05g0405900

Loading...