Os05t0405900-03

Locus

Os05g0405900

Description

Conserved hypothetical protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ATG18F

CGSNL Gene Name

AUTOPHAGY ASSOCIATED GENE 18F

Oryzabase Gene Symbol Synonym(s)

OsATG18f, OsWD40-118

Oryzabase Gene Name Synonym(s)

autophagy 18f

Transcript Evidence

AK061891 (DDBJ, Best hit)

Protein Evidence

Q6AVA5 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

001-041-G03 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0405900-03)

Others

Oryzabase (9665)

Transcript

1304 bp

>Os05t0405900-03 Conserved hypothetical protein.
TGATTTTTAATGTGACTTCATTCAAATGCGAAGTTAACAATATTCAAAGATTCAGGAATC
TTGCAATAGGACGGTTTCAGAATGCATTGACATACATCGACAAGGATAATGGTGCTCATG
GATCCAAGGCGGGGTTCCCTATATCTGGATTTTACAGTGATATGAGGAAAATGCAGAACA
TGAATGGTTTAGAGGGGCAGTTATTGTTGGAACCTATCACTAATGATTTACAACCAATGG
AAAAATGCAATTCTGTTCAATCTCCTAAAGTGGCAAATTTTACTGCCCTTCACAATGTAG
ATAATGAGAGCATGAACCATGTTTCAACAGCAACTGGAGCAACCACATCAGTCACAACAG
TGGACACTTTACCTTCAACCATCAGACCATTGAGCAGCTACTCCCTCTTGGATGGATCTC
TTGATGATGGATTACCATCACCTGCAAGTAATGTATCATTCAGGCCTCAGATAACCAACA
ATTCTTCAGTAAGCAATGGTACAATGACTGACATCTCAAATGGGTGTCTCACGAGCATCA
ATTCTGGACAGAATGAAGCATCTGATTCTCACAACTCAGTGGAGTTTACCCAGTATTTCC
AAGAGGGCTATTGTAAAATATCAGAACTCGATGACTGCCGTGAGTTAACTGAAGCTGTTA
CTGATGCTGACAGCAGCAGCAGCCACTGCGAGAGAGAGAAGCCCGAGGAAGATGGGGATA
ACGATGACATGCTTGGGGCTGTTTTTGCCTTCAGCGAAGAAGGTTGAACCTAATAATATA
CTCTGCTTTTACATAGAGAATGGAAAACAGTGCCCGTGATATTACCTAGAAAATGGTGGA
TTTCCATTAGGCTTTCGTGGAATAAATTGGTGCTGAGATGATAATCTACTATTTGGTACA
TATTAGAAAGGTGAAGCTTGTGCTCGATATCCATTTGTGAGAAGTTTTACTCAGGAATTG
AGATCAAGATCCTTCCTTCCGGGCCATTAACTAATCCACGGATCCACGTTAAGGGGAGCT
TGGTGTTGTCGAGAAGTTGCTGCTGCCTGCCGCAACACTGCCCCTTTTCCGTTGCTTTGT
ACATACTGTAAAAGACCATTTGTTTTGTGAAATACGTCTCTGGAACATTGGACGGTCCAA
CTTCCTTGGCAGCCATATTTGTTGACTGCTTCCTGCCAAGGCCTGTTAATGTTCCTTGTT
TATTTGTACAGTCTTTTCTGTTTCATTAAGGAAAAAGAAAATCTAGCAAGGATTAATGTG
ACATAACTGTATAAACATTCAGTAAAGAATTTCCGTTTACGAAG

CDS

765 bp

>Os05t0405900-03 Conserved hypothetical protein.
ATTTTTAATGTGACTTCATTCAAATGCGAAGTTAACAATATTCAAAGATTCAGGAATCTT
GCAATAGGACGGTTTCAGAATGCATTGACATACATCGACAAGGATAATGGTGCTCATGGA
TCCAAGGCGGGGTTCCCTATATCTGGATTTTACAGTGATATGAGGAAAATGCAGAACATG
AATGGTTTAGAGGGGCAGTTATTGTTGGAACCTATCACTAATGATTTACAACCAATGGAA
AAATGCAATTCTGTTCAATCTCCTAAAGTGGCAAATTTTACTGCCCTTCACAATGTAGAT
AATGAGAGCATGAACCATGTTTCAACAGCAACTGGAGCAACCACATCAGTCACAACAGTG
GACACTTTACCTTCAACCATCAGACCATTGAGCAGCTACTCCCTCTTGGATGGATCTCTT
GATGATGGATTACCATCACCTGCAAGTAATGTATCATTCAGGCCTCAGATAACCAACAAT
TCTTCAGTAAGCAATGGTACAATGACTGACATCTCAAATGGGTGTCTCACGAGCATCAAT
TCTGGACAGAATGAAGCATCTGATTCTCACAACTCAGTGGAGTTTACCCAGTATTTCCAA
GAGGGCTATTGTAAAATATCAGAACTCGATGACTGCCGTGAGTTAACTGAAGCTGTTACT
GATGCTGACAGCAGCAGCAGCCACTGCGAGAGAGAGAAGCCCGAGGAAGATGGGGATAAC
GATGACATGCTTGGGGCTGTTTTTGCCTTCAGCGAAGAAGGTTGA

Protein

254 aa

>Os05t0405900-03 Conserved hypothetical protein.
IFNVTSFKCEVNNIQRFRNLAIGRFQNALTYIDKDNGAHGSKAGFPISGFYSDMRKMQNM
NGLEGQLLLEPITNDLQPMEKCNSVQSPKVANFTALHNVDNESMNHVSTATGATTSVTTV
DTLPSTIRPLSSYSLLDGSLDDGLPSPASNVSFRPQITNNSSVSNGTMTDISNGCLTSIN
SGQNEASDSHNSVEFTQYFQEGYCKISELDDCRELTEAVTDADSSSSHCEREKPEEDGDN
DDMLGAVFAFSEEG*

5'UTR

chr05:19773527..19773528 (+ strand) : 2 bp

CDS

chr05:19773529..19773685 (+ strand) : 157 bp

chr05:19773770..19774372 (+ strand) : 603 bp

chr05:19774455..19774459 (+ strand) : 5 bp

3'UTR

chr05:19774460..19774996 (+ strand) : 537 bp

FASTA

>Os05t0405900-03 class=Sequence position=chr05:19773527..19774996 (+ strand)
TGATTTTTAA TGTGACTTCA TTCAAATGCG AAGTTAACAA TATTCAAAGA TTCAGGAATC TTGCAATAGG ACGGTTTCAG
AATGCATTGA CATACATCGA CAAGGATAAT GGTGCTCATG GATCCAAGGC GGGGTTCCCT ATATCTGGAT TTTACAGTGG
TAAGCATATG AGCGTATGAT GTCATTTGTA ATACTTCATC CCAGTTATGT GTCATAGTTA ATTGAAAAGC CTTTCTTTTG
CAGATATGAG GAAAATGCAG AACATGAATG GTTTAGAGGG GCAGTTATTG TTGGAACCTA TCACTAATGA TTTACAACCA
ATGGAAAAAT GCAATTCTGT TCAATCTCCT AAAGTGGCAA ATTTTACTGC CCTTCACAAT GTAGATAATG AGAGCATGAA
CCATGTTTCA ACAGCAACTG GAGCAACCAC ATCAGTCACA ACAGTGGACA CTTTACCTTC AACCATCAGA CCATTGAGCA
GCTACTCCCT CTTGGATGGA TCTCTTGATG ATGGATTACC ATCACCTGCA AGTAATGTAT CATTCAGGCC TCAGATAACC
AACAATTCTT CAGTAAGCAA TGGTACAATG ACTGACATCT CAAATGGGTG TCTCACGAGC ATCAATTCTG GACAGAATGA
AGCATCTGAT TCTCACAACT CAGTGGAGTT TACCCAGTAT TTCCAAGAGG GCTATTGTAA AATATCAGAA CTCGATGACT
GCCGTGAGTT AACTGAAGCT GTTACTGATG CTGACAGCAG CAGCAGCCAC TGCGAGAGAG AGAAGCCCGA GGAAGATGGG
GATAACGATG ACATGCTTGG GGCTGTTTTT GCCTTCAGCG AAGAAGGTAC TGTCTGTGAT GCAAGTTCTA TGAGGGCGTT
GCATATTTTT GCGTTGTGCT GACCTATCTC TCTTCTTTCT GGTGGCAGGT TGAACCTAAT AATATACTCT GCTTTTACAT
AGAGAATGGA AAACAGTGCC CGTGATATTA CCTAGAAAAT GGTGGATTTC CATTAGGCTT TCGTGGAATA AATTGGTGCT
GAGATGATAA TCTACTATTT GGTACATATT AGAAAGGTGA AGCTTGTGCT CGATATCCAT TTGTGAGAAG TTTTACTCAG
GAATTGAGAT CAAGATCCTT CCTTCCGGGC CATTAACTAA TCCACGGATC CACGTTAAGG GGAGCTTGGT GTTGTCGAGA
AGTTGCTGCT GCCTGCCGCA ACACTGCCCC TTTTCCGTTG CTTTGTACAT ACTGTAAAAG ACCATTTGTT TTGTGAAATA
CGTCTCTGGA ACATTGGACG GTCCAACTTC CTTGGCAGCC ATATTTGTTG ACTGCTTCCT GCCAAGGCCT GTTAATGTTC
CTTGTTTATT TGTACAGTCT TTTCTGTTTC ATTAAGGAAA AAGAAAATCT AGCAAGGATT AATGTGACAT AACTGTATAA
ACATTCAGTA AAGAATTTCC GTTTACGAAG 

Locus: Os05g0405900

Loading...

Locus: Os05g0405900

Loading...