Os05t0413200-01

Locus

Os05g0413200

Description

Beta-tubulin , Responseto gebberellin (GA) and brassinolide (BL)

RAP-DB Gene Symbol Synonym(s)

TUB6, OsTUB6, TUBB6

RAP-DB Gene Name Synonym(s)

BETA-TUBULIN 6, beta tubulin 6, Tubulin beta-6 chain, Beta-6-tubulin

CGSNL Gene Symbol

TUB6

CGSNL Gene Name

BETA-TUBULIN 6

Oryzabase Gene Symbol Synonym(s)

OsTUB6, TUBB6

Oryzabase Gene Name Synonym(s)

beta tubulin 6, Tubulin beta-6 chain, Beta-6-tubulin

Transcript Evidence

AB104732

AK122099

Protein Evidence

Q76FS3

Q0DI63

Literature

PMID: 14634157

Note

Manual Curation

February 8, 2010

Gene Ontology (GO)

Biological Process: microtubule-based process (GO:0007017)

Biological Process: protein polymerization (GO:0051258)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: structural constituent of cytoskeleton (GO:0005200)

Molecular Function: GTP binding (GO:0005525)

Cellular Component: microtubule (GO:0005874)

Cellular Component: protein complex (GO:0043234)

Functional domain (InterPro)

Tubulin (IPR000217)

Beta tubulin (IPR002453)

Tubulin/FtsZ, GTPase domain (IPR003008)

Tubulin/FtsZ, C-terminal (IPR008280)

Tubulin/FtsZ, 2-layer sandwich domain (IPR018316)

Tubulin, C-terminal (IPR023123)

Beta tubulin, autoregulation binding site (IPR013838)

Tubulin, conserved site (IPR017975)

Full-length cDNA

J033125G10 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0413200-01)

RiceXPro (AK122099)

Others

Oryzabase (2961)

KEGG (Os05t0413200-01)

Transcript

1611 bp

>Os05t0413200-01 Beta-tubulin , Responseto gebberellin (GA) and brassinolide (BL)
ACACACTCTCCCATCCCAACCTCTCCCAAAATTAGCCCCGATCCGATCGCTTCCTAGCCC
TGATTCGAGGTAAAAAAGGGGAGGAGAAGATGAGGGAGATCTTGCACATCCAGGGCGGGC
AGTGCGGGAACCAGATCGGGTCCAAGTTCTGGGAGGTGGTGTGCGACGAGCATGGCATCG
ACCCGACGGGGAGGTACGCCGGCACGTCGGACCTGCAGCTGGAGCGCGTGAACGTCTACT
ACAACGAGGCGTCGTGCGGCCGGTTCGTGCCGCGCGCCGTGCTCATGGACCTGGAGCCGG
GCACCATGGACTCCGTCCGCACGGGGCCCTACGGCCAGATCTTCCGTCCCGACAACTTCG
TCTTCGGCCAGTCCGGCGCCGGCAACAACTGGGCCAAGGGCCACTACACCGAGGGCGCCG
AGCTCATCGACTCCGTCCTCGACGTCGTCCGCAAGGAGGCCGAGAATTGCGACTGCCTCC
AAGGTTTCCAGGTGTGCCACTCGCTGGGCGGCGGCACGGGCTCCGGCATGGGCACCCTGC
TGATCTCCAAGATCAGGGAGGAGTACCCGGACAGGATGATGCTCACCTTCTCCGTGTTCC
CGTCGCCCAAGGTGTCGGACACCGTGGTGGAGCCCTACAACGCCACGCTCTCGGTCCACC
AGCTCGTGGAGAACGCCGACGAGTGCATGGTGCTCGACAACGAGGCGCTCTATGACATCT
GCTTCCGCACCCTCAAGCTGACGACTCCCAGCTttggtgatctgaaccacttgattagtg
ccaccatgagcggtgtcacctgctgcctgcgcttcccagggcagctgaactccgacctcc
gcaagctcgccgtcaacctgatccccttcccgcggctccacttcttcatggtgggcttcg
cgccgctcacctcacgcggctcgcagcagtaccgcgccctcactgtccctgagctcaccc
agcagatgtgggacgccaagaacatgatgtgcgccgccgacccgcgccacggccgctacc
tgacggcctcggccatgttccgcggcaagatgagcaccaaggaggtggacgagcagatga
tcaacgtgcagaacaagaaCTCGTCCTACTTCGTGGAGTGGATCCCCAACAACGTCAAGT
CGAGCGTGTGTGACATCCCGCCGCGCGGCCTCTCCATGGCGTCTACGTTCGTCGGCAACT
CCACCTCCATCCAGGAGATGTTCCGCCGCGTCAGCGAGCAGTTCACGGCCATGTTCAGGA
GGAAGGCGTTCTTGCACTGGTACACGGGCGAGGGCATGGACGAGATGGAGTTCACCGAGG
CGGAGAGCAACATGAACGACCTCGTCTCCGAGTACCAGCAGTATCAGGACGCCACCGCCG
ACGAGGCCGAGTACGAGGAAGAAGAGGACGCGATACAGGAGTAGAGACTGTCTGGGCAAT
GGTACCTCGTATCCCCTGCCCATCGTTACCCTAATATGTTTGCCTGAACATCATCGCAGT
TGCATCACCATAGCTACCTCCGCACCTTAAAATTTGATGCTTGTTTGTATGCTATCGCGT
GTATCAGGAGTGCGTACTGGTTCCGTATGCTAAAGTCTTGGCTATTGATGT

CDS

1335 bp

>Os05t0413200-01 Beta-tubulin , Responseto gebberellin (GA) and brassinolide (BL)
ATGAGGGAGATCTTGCACATCCAGGGCGGGCAGTGCGGGAACCAGATCGGGTCCAAGTTC
TGGGAGGTGGTGTGCGACGAGCATGGCATCGACCCGACGGGGAGGTACGCCGGCACGTCG
GACCTGCAGCTGGAGCGCGTGAACGTCTACTACAACGAGGCGTCGTGCGGCCGGTTCGTG
CCGCGCGCCGTGCTCATGGACCTGGAGCCGGGCACCATGGACTCCGTCCGCACGGGGCCC
TACGGCCAGATCTTCCGTCCCGACAACTTCGTCTTCGGCCAGTCCGGCGCCGGCAACAAC
TGGGCCAAGGGCCACTACACCGAGGGCGCCGAGCTCATCGACTCCGTCCTCGACGTCGTC
CGCAAGGAGGCCGAGAATTGCGACTGCCTCCAAGGTTTCCAGGTGTGCCACTCGCTGGGC
GGCGGCACGGGCTCCGGCATGGGCACCCTGCTGATCTCCAAGATCAGGGAGGAGTACCCG
GACAGGATGATGCTCACCTTCTCCGTGTTCCCGTCGCCCAAGGTGTCGGACACCGTGGTG
GAGCCCTACAACGCCACGCTCTCGGTCCACCAGCTCGTGGAGAACGCCGACGAGTGCATG
GTGCTCGACAACGAGGCGCTCTATGACATCTGCTTCCGCACCCTCAAGCTGACGACTCCC
AGCTttggtgatctgaaccacttgattagtgccaccatgagcggtgtcacctgctgcctg
cgcttcccagggcagctgaactccgacctccgcaagctcgccgtcaacctgatccccttc
ccgcggctccacttcttcatggtgggcttcgcgccgctcacctcacgcggctcgcagcag
taccgcgccctcactgtccctgagctcacccagcagatgtgggacgccaagaacatgatg
tgcgccgccgacccgcgccacggccgctacctgacggcctcggccatgttccgcggcaag
atgagcaccaaggaggtggacgagcagatgatcaacgtgcagaacaagaaCTCGTCCTAC
TTCGTGGAGTGGATCCCCAACAACGTCAAGTCGAGCGTGTGTGACATCCCGCCGCGCGGC
CTCTCCATGGCGTCTACGTTCGTCGGCAACTCCACCTCCATCCAGGAGATGTTCCGCCGC
GTCAGCGAGCAGTTCACGGCCATGTTCAGGAGGAAGGCGTTCTTGCACTGGTACACGGGC
GAGGGCATGGACGAGATGGAGTTCACCGAGGCGGAGAGCAACATGAACGACCTCGTCTCC
GAGTACCAGCAGTATCAGGACGCCACCGCCGACGAGGCCGAGTACGAGGAAGAAGAGGAC
GCGATACAGGAGTAG

Protein

445 aa

>Os05t0413200-01 Beta-tubulin , Responseto gebberellin (GA) and brassinolide (BL)
MREILHIQGGQCGNQIGSKFWEVVCDEHGIDPTGRYAGTSDLQLERVNVYYNEASCGRFV
PRAVLMDLEPGTMDSVRTGPYGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELIDSVLDVV
RKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVV
EPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCL
RFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQQYRALTVPELTQQMWDAKNMM
CAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPRG
LSMASTFVGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEAEYEEEEDAIQE*

5'UTR

chr05:20204138..20204206 (+ strand) : 69 bp

chr05:20204652..20204671 (+ strand) : 20 bp

CDS

chr05:20204672..20205065 (+ strand) : 394 bp

chr05:20205167..20205436 (+ strand) : 270 bp

chr05:20206425..20207095 (+ strand) : 671 bp

3'UTR

chr05:20207096..20207282 (+ strand) : 187 bp

FASTA

>Os05t0413200-01 class=Sequence position=chr05:20204138..20207282 (+ strand)
ACACACTCTC CCATCCCAAC CTCTCCCAAA ATTAGCCCCG ATCCGATCGC TTCCTAGCCC TGATTCGAGG TGAATTCCGC
AACAAAAAAT CTTTCGATTC GCTTCCCCCC GAATTATCTA GCGCCTCGTG CTTTCCGGTG AATTTTTTTT TGGGTCCGAT
CGATTCTTTT TTTTTTTTTT TGGGGGGGGG GGGGGTTGGG TGGATTATTG AGGATTTGAG GTGTTCTTGG TGCGATCGGA
ACATTTTTGG TTCGTTTGTT TGGGGATTCT TGCGGTGTTC TGGGTAGAAT CAGGACTAGC TGTTCTTCTC GGTGTTCCGA
TCGTTTGGGG ATTAGTGAGG ATTTGAGGTG TTCTTGGTGC GATCAGAAGA TTTTTGGTTC GTTTTTTTTT CTCTTTCGGA
TTCTTGCGGT GTTCTTGGTA GAATCAGTAC TCTCGGTGTT CCGATTCCCG CGTTGGAATT TCAGAAGGTC TCACCCACCC
TGACGTTTCG CGTTTCGTGG CGATTTCTCT GCAGGTAAAA AAGGGGAGGA GAAGATGAGG GAGATCTTGC ACATCCAGGG
CGGGCAGTGC GGGAACCAGA TCGGGTCCAA GTTCTGGGAG GTGGTGTGCG ACGAGCATGG CATCGACCCG ACGGGGAGGT
ACGCCGGCAC GTCGGACCTG CAGCTGGAGC GCGTGAACGT CTACTACAAC GAGGCGTCGT GCGGCCGGTT CGTGCCGCGC
GCCGTGCTCA TGGACCTGGA GCCGGGCACC ATGGACTCCG TCCGCACGGG GCCCTACGGC CAGATCTTCC GTCCCGACAA
CTTCGTCTTC GGCCAGTCCG GCGCCGGCAA CAACTGGGCC AAGGGCCACT ACACCGAGGG CGCCGAGCTC ATCGACTCCG
TCCTCGACGT CGTCCGCAAG GAGGCCGAGA ATTGCGACTG CCTCCAAGGT ATCATCATCA TCATACCATC ACCCCCACTA
TCTGTTTCGT TTCTTGAATT CTTTTCCATG GAATCCGGTG GTCGATCGAG CTCTGCTTCC GGTGGTCAGG TTTCCAGGTG
TGCCACTCGC TGGGCGGCGG CACGGGCTCC GGCATGGGCA CCCTGCTGAT CTCCAAGATC AGGGAGGAGT ACCCGGACAG
GATGATGCTC ACCTTCTCCG TGTTCCCGTC GCCCAAGGTG TCGGACACCG TGGTGGAGCC CTACAACGCC ACGCTCTCGG
TCCACCAGCT CGTGGAGAAC GCCGACGAGT GCATGGTGCT CGACAACGAG GCGCTCTATG ACATCTGCTT CCGCACCCTC
AAGCTGACGA CTCCCAGCTG TGAGCATATC CCTGCCATTG ATACCTGTTC TTTTGTTATA CTACTAAGTT TTACTGAATT
AGATTATCAT TTCTGCAATA TTATGAGAAA TTTCAGTTCA CTAAGTCATC TTGAAGTGCT TTGTGCTTTA TGAAAAAGGT
CGTTGTATGT CATTTTCGTT TCACTAGTGC GAAACTACTG CTTCACATAT CCAAAATGTT GTGAGGAGCT TAATCATCTT
AATTAGGTGA TGCCAGCTGA CTTAGTTTGG TTCCTTGTAA AGGATTATTA GTGTTGGATT CGTTTATACC ATTATATGTA
GTTGGTGTGC TTGACTTGTT TATCCAACCA ACCACCAGTT TAAATGAGCT GACTGAACTA AATCTCATCA AATCTCttag
gccgagttta gttccaaact ttttcttcaa acttccaact tttccatcac atcaaaactt tcatacacac aaacttccaa
cttttccgtt acatcgttcc aatttcaacc aaacttccaa ttttggtgtg aactaaacat accctTAGTA CATAAGTTTT
GCCTTGTAGT TGAAATAATA ACTGCACTTA TTCCACATAC TGTGTTACAT AAAGGGAGTA TGAACTGTTA AATGTTACTA
GAAGGTCTGA TGCTGGGTAT GACTTGAGGG TTGTTTTCTG CACCATTTTC CATATCGCTA ATACTTCTGT AGCTTGGAGT
TGGGGCATGT TTTCCAGCAT AAGAATGATA TCCCCTTAAT TAGAAATGTG TGGTAATGAA AATTCTTGTA GTGTCAACTG
AAACCAAAAC ATCAGTTCAG TTCTGAACTT CTAAATTCTA AAAGCAAACA TGCTACTACT TTATTTAATT TGTTTTTTCT
GCTGATGTAT TCTTTTGGTG ATCTTTTATC TAGTAACATT TGTTATGATT AAAAGCCAAG CTGATATGTT TACTTATTAG
GCTCTTGCTG TGCTACTGCT CATCTGAATC TTGATTTTTG CGGACAGttg gtgatctgaa ccacttgatt agtgccacca
tgagcggtgt cacctgctgc ctgcgcttcc cagggcagct gaactccgac ctccgcaagc tcgccgtcaa cctgatcccc
ttcccgcggc tccacttctt catggtgggc ttcgcgccgc tcacctcacg cggctcgcag cagtaccgcg ccctcactgt
ccctgagctc acccagcaga tgtgggacgc caagaacatg atgtgcgccg ccgacccgcg ccacggccgc tacctgacgg
cctcggccat gttccgcggc aagatgagca ccaaggaggt ggacgagcag atgatcaacg tgcagaacaa gaaCTCGTCC
TACTTCGTGG AGTGGATCCC CAACAACGTC AAGTCGAGCG TGTGTGACAT CCCGCCGCGC GGCCTCTCCA TGGCGTCTAC
GTTCGTCGGC AACTCCACCT CCATCCAGGA GATGTTCCGC CGCGTCAGCG AGCAGTTCAC GGCCATGTTC AGGAGGAAGG
CGTTCTTGCA CTGGTACACG GGCGAGGGCA TGGACGAGAT GGAGTTCACC GAGGCGGAGA GCAACATGAA CGACCTCGTC
TCCGAGTACC AGCAGTATCA GGACGCCACC GCCGACGAGG CCGAGTACGA GGAAGAAGAG GACGCGATAC AGGAGTAGAG
ACTGTCTGGG CAATGGTACC TCGTATCCCC TGCCCATCGT TACCCTAATA TGTTTGCCTG AACATCATCG CAGTTGCATC
ACCATAGCTA CCTCCGCACC TTAAAATTTG ATGCTTGTTT GTATGCTATC GCGTGTATCA GGAGTGCGTA CTGGTTCCGT
ATGCTAAAGT CTTGGCTATT GATGT

Locus: Os05g0413200

Loading...

Locus: Os05g0413200

Loading...