Os05t0417100-01

Locus

Os05g0417100

Description

Chloroplast-targeted Deg protease protein, Chloroplast development and maintenance of PSII function under high temperatures

RAP-DB Gene Symbol Synonym(s)

OsDeg10, OsDegP7, TCM5

RAP-DB Gene Name Synonym(s)

Deg protease 7, THERMO-SENSITIVE CHLOROPHYLL-DEFICIENT MUTANT 5, thermo-sensitive chlorophyll-deficient mutant 5

CGSNL Gene Symbol

TCM5

CGSNL Gene Name

THERMO-SENSITIVE CHLOROPHYLL-DEFICIENT MUTANT 5

Oryzabase Gene Symbol Synonym(s)

OsDegp7, DEGP7, OsDeg10

Oryzabase Gene Name Synonym(s)

Deg protease 7, DEG PROTEASE 7, thermo-sensitive chlorophyll-deficient mutant 5

Transcript Evidence

AK073199

Protein Evidence

Q6AT72

Literature

PMID: 27000876

PMID: 22520048

Note

Manual Curation

June 16, 2017

Gene Ontology (GO)

Biological Process: proteolysis (GO:0006508)

Molecular Function: serine-type endopeptidase activity (GO:0004252)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Peptidase S1C (IPR001940)

Peptidase S1, PA clan (IPR009003)

PDZ domain (IPR001478)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

Full-length cDNA

J033023K08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0417100-01)

RiceXPro (AK073199)

Others

Oryzabase (20083)

KEGG (Os05t0417100-01)

Transcript

2367 bp

>Os05t0417100-01 Chloroplast-targeted Deg protease protein, Chloroplast development and maintenance of PSII function under high temperatures
GACCGCCTCCTGCCCCGCGCCGCGCCGCGCCGCTTCTTCCGGCGAGGCCGCCCCGCCACC
ACCATGCTCGCCTCCGTCCGCTCTCTCCGCCGCCTCTCCTCCTCCTCCTCGTCCTCGTCC
TTGTCCCCCGCCTCGCTACGCCGCCTCCTCCTCCTCCTCCACCGCCCGCCGCCTCCGCCC
CCGCCCCCTCGGCCTCCTCTCCCGCCCTTCCAAACCCTAGCCCGAGGCATCCTGCCGCGC
ATCGCGGCGCGGCCTGTGCCCCGCCGCTTCTCCACCGCGTCCTGCTCCTCCACGCTCTTC
CGCGTGGGGGAATGCGGCGCCCCCGGCGCCACCGCCATACCCGAGGCGGAGCGAGGCGAG
GAGGAGGAGCGTGAGGGGGAGGATGGAGGCGAGGCCGACGCGGCGGTGGAGGTGGCGGCG
GGGAGGCATGACACGGACGCGTACGCGGCGGTGGAGCTGGCGCTGGACTCGGTGGTGAAG
GTTTTCACGGTGTCCAGTAGCCCCAACTACTTCCTGCCGTGGCAGAACAAGGCGCAGCGC
GAGAGCATGGGCTCAGGATTTGTAATTCCGGGGAGGAGAATCATCACAAATGCTCATGTT
ATAGCGGATCATACCTTTGTTCTCGTGAGGAAGCATGGGTCGCCTACTAAGTACAAGGCA
GAAGTCCAGGCTGTTGGCCATGAGTGCGACTTGGCTCTTCTGAAAGTTGATAGTGAGGAG
TTTTGGGATGGAATGAACAGTTTGGAGCTTGGAGACATTCCCTTCTTGCAGGAAGCAGTT
GCTGTGGTTGGCTACCCGCAAGGGGGGGACAACATTTCTGTCACCAAGGGTGTGGTCTCT
AGAGTTGAGCCAACACAATATGCACATGGTGCTACTCAGCTCATGGCCATACAAATAGAT
GCGGCTATCAACCCAGGAAACAGCGGAGGGCCTGCAATTATGGGCGACAAAGTTGCTGGA
GTTGCTTTTCAAAATTTATCAGGGGCAGAAAACATTGGGTATATTATACCGGTGCCTGTA
ATTAAACGTTTCATCTCTGGAGTGGAAGAGAGCGGTAAATATTCTGGTTTTTGTACCCTT
GGAATATCTTGCCAGGCCACAGAGAATATTCAATTAAGAGAGTGCTTTGGGATGAAGCCT
GATTTGACTGGAGTGTTAGTGAGTAGAATAAATCCTCTATCTGATGCTCACAGAGTTCTT
AAGAAAGATGACATTCTTCTTGAGTTTGACGGTGTGCCTATAGCAAATGATGGCACAGTC
CCATTTCGAAATAGGGAGAGAATCACCTTCGATCATCTGGTGTCCATGAAGAAGCCTGGG
GAAATGGCGGTTCTCAAAGTTCTAAGAGATGGCAAAGAGCATGAATTGAATGTCACTGTT
AGACCTTTGCAACCTTTAGTCCCTGTACATCAATTTGATAAACTACCCAGCTACTACATC
TTTGCTGGTTTTGTTTTCATCCCACTGACCCAGCCTTATCTCCATGAATTTGGAGAAGAC
TGGTACAACAATTCGCCACGCCGACTGTGTGAACGGGCACTGAGAGAGCTTCCAAAAAAA
GCTGCTGAACAACTAGTTATCCTATCTCAGGTTCTCATGGATGATATTAATGTTGGTTAT
GAAAGGCTCGCTGAACTACAGGTAAAAAAGGTGAACGGTGTGGAAGTAGAAAATCTGAAG
CATCTGTGCAGCCTTGTGGAAAGCTGCACTGAAGAAAACCTGAGATTTGATCTGGACGAT
GAGCGGGTGATCGTCCTGAAATATCAGAACGCAAAGCTCGCCACGTCCCGGATCTTAAAA
CGGCACAGGATACCGTCGGCCATATCTGCTGACCTCGTCGACGAACAGGCGACTGACGAC
GGTGAGGAGGCGACTAATGGTGAGATCGAGGCATCATGCACTAGCTAACATTGTTTTGCA
TACTTAGCTAGGCAATTACCTGCGGAAGAATAGATAGATATTAGCACGGTTCAATTTCCA
GAGACAGACGCAGTGAGGCGAGGACTGCCCGGAGCACTGCGCTGGTTGCAGCGGCTCCTG
TTCGGCCGTCTCAGTTTTGACGTGAGGGGTGGGTGCTCCGGTTTCCCTCAGCAAATAAGA
AGTGAAGAACCCAAGTTCTTCAGCCTCATGATATGTTGTAACACAAATTATCTTCCCCAT
TTCTTCCCAATATTTCTCATTCTTTCACCAAAAGTGCCGTGGCACAGTCACCTCATATTG
AACTCAGATTATATATATCATCACGAAACAGAGCATATGAAACAGGAGTTACAAAGTTTA
CAGCTCGATGAAAATCCACAATAAGTTTCTTATGTACTTTCTTGGTAAATTATCACCCTT
GCTGTtaatccctccatttcatattat

CDS

1845 bp

>Os05t0417100-01 Chloroplast-targeted Deg protease protein, Chloroplast development and maintenance of PSII function under high temperatures
ATGCTCGCCTCCGTCCGCTCTCTCCGCCGCCTCTCCTCCTCCTCCTCGTCCTCGTCCTTG
TCCCCCGCCTCGCTACGCCGCCTCCTCCTCCTCCTCCACCGCCCGCCGCCTCCGCCCCCG
CCCCCTCGGCCTCCTCTCCCGCCCTTCCAAACCCTAGCCCGAGGCATCCTGCCGCGCATC
GCGGCGCGGCCTGTGCCCCGCCGCTTCTCCACCGCGTCCTGCTCCTCCACGCTCTTCCGC
GTGGGGGAATGCGGCGCCCCCGGCGCCACCGCCATACCCGAGGCGGAGCGAGGCGAGGAG
GAGGAGCGTGAGGGGGAGGATGGAGGCGAGGCCGACGCGGCGGTGGAGGTGGCGGCGGGG
AGGCATGACACGGACGCGTACGCGGCGGTGGAGCTGGCGCTGGACTCGGTGGTGAAGGTT
TTCACGGTGTCCAGTAGCCCCAACTACTTCCTGCCGTGGCAGAACAAGGCGCAGCGCGAG
AGCATGGGCTCAGGATTTGTAATTCCGGGGAGGAGAATCATCACAAATGCTCATGTTATA
GCGGATCATACCTTTGTTCTCGTGAGGAAGCATGGGTCGCCTACTAAGTACAAGGCAGAA
GTCCAGGCTGTTGGCCATGAGTGCGACTTGGCTCTTCTGAAAGTTGATAGTGAGGAGTTT
TGGGATGGAATGAACAGTTTGGAGCTTGGAGACATTCCCTTCTTGCAGGAAGCAGTTGCT
GTGGTTGGCTACCCGCAAGGGGGGGACAACATTTCTGTCACCAAGGGTGTGGTCTCTAGA
GTTGAGCCAACACAATATGCACATGGTGCTACTCAGCTCATGGCCATACAAATAGATGCG
GCTATCAACCCAGGAAACAGCGGAGGGCCTGCAATTATGGGCGACAAAGTTGCTGGAGTT
GCTTTTCAAAATTTATCAGGGGCAGAAAACATTGGGTATATTATACCGGTGCCTGTAATT
AAACGTTTCATCTCTGGAGTGGAAGAGAGCGGTAAATATTCTGGTTTTTGTACCCTTGGA
ATATCTTGCCAGGCCACAGAGAATATTCAATTAAGAGAGTGCTTTGGGATGAAGCCTGAT
TTGACTGGAGTGTTAGTGAGTAGAATAAATCCTCTATCTGATGCTCACAGAGTTCTTAAG
AAAGATGACATTCTTCTTGAGTTTGACGGTGTGCCTATAGCAAATGATGGCACAGTCCCA
TTTCGAAATAGGGAGAGAATCACCTTCGATCATCTGGTGTCCATGAAGAAGCCTGGGGAA
ATGGCGGTTCTCAAAGTTCTAAGAGATGGCAAAGAGCATGAATTGAATGTCACTGTTAGA
CCTTTGCAACCTTTAGTCCCTGTACATCAATTTGATAAACTACCCAGCTACTACATCTTT
GCTGGTTTTGTTTTCATCCCACTGACCCAGCCTTATCTCCATGAATTTGGAGAAGACTGG
TACAACAATTCGCCACGCCGACTGTGTGAACGGGCACTGAGAGAGCTTCCAAAAAAAGCT
GCTGAACAACTAGTTATCCTATCTCAGGTTCTCATGGATGATATTAATGTTGGTTATGAA
AGGCTCGCTGAACTACAGGTAAAAAAGGTGAACGGTGTGGAAGTAGAAAATCTGAAGCAT
CTGTGCAGCCTTGTGGAAAGCTGCACTGAAGAAAACCTGAGATTTGATCTGGACGATGAG
CGGGTGATCGTCCTGAAATATCAGAACGCAAAGCTCGCCACGTCCCGGATCTTAAAACGG
CACAGGATACCGTCGGCCATATCTGCTGACCTCGTCGACGAACAGGCGACTGACGACGGT
GAGGAGGCGACTAATGGTGAGATCGAGGCATCATGCACTAGCTAA

Protein

615 aa

>Os05t0417100-01 Chloroplast-targeted Deg protease protein, Chloroplast development and maintenance of PSII function under high temperatures
MLASVRSLRRLSSSSSSSSLSPASLRRLLLLLHRPPPPPPPPRPPLPPFQTLARGILPRI
AARPVPRRFSTASCSSTLFRVGECGAPGATAIPEAERGEEEEREGEDGGEADAAVEVAAG
RHDTDAYAAVELALDSVVKVFTVSSSPNYFLPWQNKAQRESMGSGFVIPGRRIITNAHVI
ADHTFVLVRKHGSPTKYKAEVQAVGHECDLALLKVDSEEFWDGMNSLELGDIPFLQEAVA
VVGYPQGGDNISVTKGVVSRVEPTQYAHGATQLMAIQIDAAINPGNSGGPAIMGDKVAGV
AFQNLSGAENIGYIIPVPVIKRFISGVEESGKYSGFCTLGISCQATENIQLRECFGMKPD
LTGVLVSRINPLSDAHRVLKKDDILLEFDGVPIANDGTVPFRNRERITFDHLVSMKKPGE
MAVLKVLRDGKEHELNVTVRPLQPLVPVHQFDKLPSYYIFAGFVFIPLTQPYLHEFGEDW
YNNSPRRLCERALRELPKKAAEQLVILSQVLMDDINVGYERLAELQVKKVNGVEVENLKH
LCSLVESCTEENLRFDLDDERVIVLKYQNAKLATSRILKRHRIPSAISADLVDEQATDDG
EEATNGEIEASCTS*

5'UTR

chr05:20433366..20433428 (+ strand) : 63 bp

CDS

chr05:20433429..20433921 (+ strand) : 493 bp

chr05:20434383..20434628 (+ strand) : 246 bp

chr05:20435487..20435682 (+ strand) : 196 bp

chr05:20435763..20436022 (+ strand) : 260 bp

chr05:20436180..20436307 (+ strand) : 128 bp

chr05:20436693..20436896 (+ strand) : 204 bp

chr05:20437026..20437076 (+ strand) : 51 bp

chr05:20437207..20437473 (+ strand) : 267 bp

3'UTR

chr05:20437474..20437932 (+ strand) : 459 bp

FASTA

>Os05t0417100-01 class=Sequence position=chr05:20433366..20437932 (+ strand)
GACCGCCTCC TGCCCCGCGC CGCGCCGCGC CGCTTCTTCC GGCGAGGCCG CCCCGCCACC ACCATGCTCG CCTCCGTCCG
CTCTCTCCGC CGCCTCTCCT CCTCCTCCTC GTCCTCGTCC TTGTCCCCCG CCTCGCTACG CCGCCTCCTC CTCCTCCTCC
ACCGCCCGCC GCCTCCGCCC CCGCCCCCTC GGCCTCCTCT CCCGCCCTTC CAAACCCTAG CCCGAGGCAT CCTGCCGCGC
ATCGCGGCGC GGCCTGTGCC CCGCCGCTTC TCCACCGCGT CCTGCTCCTC CACGCTCTTC CGCGTGGGGG AATGCGGCGC
CCCCGGCGCC ACCGCCATAC CCGAGGCGGA GCGAGGCGAG GAGGAGGAGC GTGAGGGGGA GGATGGAGGC GAGGCCGACG
CGGCGGTGGA GGTGGCGGCG GGGAGGCATG ACACGGACGC GTACGCGGCG GTGGAGCTGG CGCTGGACTC GGTGGTGAAG
GTTTTCACGG TGTCCAGTAG CCCCAACTAC TTCCTGCCGT GGCAGAACAA GGCGCAGCGC GAGAGCATGG GCTCAGGTAA
GCTTAGCAAA TCTCAAGCAG TCAGCAGCGA GAGTCCTGAG TAGCGTGTTT CGATCTCTGT TGCTGCGGTA GATGCGTAGG
TATGGCGGGC AAGCGATTGC CATTTCTATT GCATGGATCG GTGGAGTGTT ACCTTGATGC TGATTGGGCT TATTTTGACC
TTTTATCGAT GATCAATAAC GGGGTAGTTT GCTGGTTTCA ACTGACAAAG ACAGTGCGCC CAATTTATGT ATTTCTGCTA
GTGTGTACTT ACTAATTAGT ATGATGAAAT GTGCTTCTTG GTTTATGGTA GTCACATGGA GTGCCCTACT ATGTTTCATG
AACTTTTGAA ATGACCTTGC TGTGGGATAA GCCGAACAAA TCAGTCATTT GTGGGTTGCT AACTGAGAAA ACCTTCTGAA
GTTATGCTTG TTTTTTTGGA CTTTTGGTTC ATCTGCTAAT GCATGTCTGT GTTGTAGGAT TTGTAATTCC GGGGAGGAGA
ATCATCACAA ATGCTCATGT TATAGCGGAT CATACCTTTG TTCTCGTGAG GAAGCATGGG TCGCCTACTA AGTACAAGGC
AGAAGTCCAG GCTGTTGGCC ATGAGTGCGA CTTGGCTCTT CTGAAAGTTG ATAGTGAGGA GTTTTGGGAT GGAATGAACA
GTTTGGAGCT TGGAGACATT CCCTTCTTGC AGGAAGCAGT TGCTGTGGTT GGCTACCCGC AAGGTATCAA TTTTGAAACT
AACAGTCCTA TATCATTTGC AGTATTATGT GCTTAGATGT TAAACTTGAT AGTTTTATGA TTTCATCCAC TGAACGCATT
GAAGTCTATG CAAATGCCAT ACCCTAACCA TCTAGTTTGT ATCGGCGTAC TGTTCTGTTG TAAATGAATG ACAATGATCT
AATTGATCAC TGAAAGGTCA GTTAGACAAA TATGCTAATG AAATTTTACA CAATTTTGAA AGAAAGTAAA ATTTACCCTA
TGTTTGTAAC CCACTTTTAA CATTTGTATA GATAATTTAT CATGCCATTA GATTCATCAT TTTACCCTTT GTTTGTAATC
CACTTTTAAC ATTAACATTC ATAtactccc tccatttcac aatgtaagac tttctagcat tgtctacatt catatagatg
ttaatgtggg caatatattt gtctagattc attaatatct atacgaatgc gggcaatgct agaaagtctt aaattgtgaa
atggaggaag taGATAATTT ATTATGCTGT TAGACTCATC ATTATGAGAT TATTTTTTTT TGTATCCCCA ACAATTTTTA
TGTGGTAGAT ATTCCTCCTA GCTTCACCTT ATACCACATG AACAGCAAGG TACTACACAC TTCTCTGTTG AGTGATACCA
TGATGATCTA TCTATGCATG CATGTTTACA CAGTTAATTC AGATAGATTA AAATTTTCTC GTGCAGCTTT TCTGCCTCTG
ATGCTATTGC TAGCATGAAT AGCTTTATAG GGCCTTCTCA GTTCTTACTG TAACTATTCT TGTTAGAAAG AAAATCATAA
AAATGTGAAC AAATTTATGT TTCTGGCTTT CCATTGCTCA GGGGGGGACA ACATTTCTGT CACCAAGGGT GTGGTCTCTA
GAGTTGAGCC AACACAATAT GCACATGGTG CTACTCAGCT CATGGCCATA CAAATAGATG CGGCTATCAA CCCAGGAAAC
AGCGGAGGGC CTGCAATTAT GGGCGACAAA GTTGCTGGAG TTGCTTTTCA AAATTTATCA GGGGCAGAAA ACATTGGGTA
GGTCCCTGAA ATAACTTTCT AGTCATGCAC CAATTGAACC CCTTGCTTTA GCTAGAAATG TAATCCTCCT CTTTCAGGTA
TATTATACCG GTGCCTGTAA TTAAACGTTT CATCTCTGGA GTGGAAGAGA GCGGTAAATA TTCTGGTTTT TGTACCCTTG
GAATATCTTG CCAGGCCACA GAGAATATTC AATTAAGAGA GTGCTTTGGG ATGAAGCCTG ATTTGACTGG AGTGTTAGTG
AGTAGAATAA ATCCTCTATC TGATGCTCAC AGAGTTCTTA AGAAAGATGA CATTCTTCTT GAGTTTGACG GTGTGCCTAT
AGCAAATGAT GGCACAGGTG GGCTTCACAC GACTGTGTAC TTTTACATAT TTTGGTTTCA TGTTCCTGTA TTATTTTACC
TGGTAGATCA TAGCACATAA CTATCCTTGG ACAAAATATT TGGTATGCCT TGAGTACATT TTTTTTTTCA CACCAGCTTT
TTTAATGCCT GCAGTCCCAT TTCGAAATAG GGAGAGAATC ACCTTCGATC ATCTGGTGTC CATGAAGAAG CCTGGGGAAA
TGGCGGTTCT CAAAGTTCTA AGAGATGGCA AAGAGCATGA ATTGAATGTC ACTGTTAGAC CTGTGAGTAC TTGCAATGTT
GCTTATAGAA GTTATACATT TTGATTAACC AGAGTGTTTT TTCTTTCTGC TGCTGGTTAC TAATATGATT CAAATGCTAC
TCTCTTTTAT CCTTGCACCT AGTTTTGCTA GTTTTAGGCA TGGGTAATGG ACTCAACCTT CTCCAAACTT ATAATAGTCA
TTATATAGAG ATTTATGTGC AGAACTGCAG ATGTATCAGA TATCTCAATG ATCTCTGTAG GCTAACAAAT TGGACCCAAG
TATTTTGTAC ACATGCTTCC ACGCCTATGC TTTGCATTCA TCATTTCACT TTGCACTTAC TTGACCTGTT CAAGTGCTTT
TTGGATACGT ACACTGGAAA TGATCTTATA TATAATTTAT TGTGCAGTTG CAACCTTTAG TCCCTGTACA TCAATTTGAT
AAACTACCCA GCTACTACAT CTTTGCTGGT TTTGTTTTCA TCCCACTGAC CCAGCCTTAT CTCCATGAAT TTGGAGAAGA
CTGGTACAAC AATTCGCCAC GCCGACTGTG TGAACGGGCA CTGAGAGAGC TTCCAAAAAA AGCTGCTGAA CAACTAGTTA
TCCTATCTCA GGTACTACTT CGCCATCCTT CTCTATTCTA GTACATTTCA AATTAGCTGC TTCAGGATCT TATGAGTATT
GCAGGAAACA TTCTGCTGAA CTTTTCAGTA TATGTGTTCT CACCGATTAT TTTGTCTTAG GTTCTCATGG ATGATATTAA
TGTTGGTTAT GAAAGGCTCG CTGAACTACA GGTACCGTTG CTGTACAGAA ATCCTTAGTT TTCACTACCC AAGAACAGAA
ATTCTTCAGC ATTCTACATT TCTACACATA TGTAGTGTCC AGTAGGACAT GCACTGATGA AGCTGCATAA TATATGATCA
GGTAAAAAAG GTGAACGGTG TGGAAGTAGA AAATCTGAAG CATCTGTGCA GCCTTGTGGA AAGCTGCACT GAAGAAAACC
TGAGATTTGA TCTGGACGAT GAGCGGGTGA TCGTCCTGAA ATATCAGAAC GCAAAGCTCG CCACGTCCCG GATCTTAAAA
CGGCACAGGA TACCGTCGGC CATATCTGCT GACCTCGTCG ACGAACAGGC GACTGACGAC GGTGAGGAGG CGACTAATGG
TGAGATCGAG GCATCATGCA CTAGCTAACA TTGTTTTGCA TACTTAGCTA GGCAATTACC TGCGGAAGAA TAGATAGATA
TTAGCACGGT TCAATTTCCA GAGACAGACG CAGTGAGGCG AGGACTGCCC GGAGCACTGC GCTGGTTGCA GCGGCTCCTG
TTCGGCCGTC TCAGTTTTGA CGTGAGGGGT GGGTGCTCCG GTTTCCCTCA GCAAATAAGA AGTGAAGAAC CCAAGTTCTT
CAGCCTCATG ATATGTTGTA ACACAAATTA TCTTCCCCAT TTCTTCCCAA TATTTCTCAT TCTTTCACCA AAAGTGCCGT
GGCACAGTCA CCTCATATTG AACTCAGATT ATATATATCA TCACGAAACA GAGCATATGA AACAGGAGTT ACAAAGTTTA
CAGCTCGATG AAAATCCACA ATAAGTTTCT TATGTACTTT CTTGGTAAAT TATCACCCTT GCTGTtaatc cctccatttc
atattat

Locus: Os05g0417100

Loading...

Locus: Os05g0417100

Loading...