Os05t0419200-01

Locus

Os05g0419200

Description

Protein of unknown function DUF647 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS6B

CGSNL Gene Name

ROOT UV-B SENSITIVE 6B

Oryzabase Gene Symbol Synonym(s)

OsRUS6B

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK071273 (DDBJ, Best hit)

Protein Evidence

NP_568713.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Full-length cDNA

J023087G18 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0419200-01)

RiceXPro (AK071273)

Others

Oryzabase (21452)

KEGG (Os05t0419200-01)

Transcript

1876 bp

>Os05t0419200-01 Protein of unknown function DUF647 family protein.
GAGTGCCTCGCTGTTTCGCCGCACCCATCGAAATCTCACCCGCTCTCTCTCTCTCGCGCG
CGCGCCGCCGAGGAAGTGGAGCTACGTGGTGGAGGGGGGCGCGTCCCCCGGGAAGGCCGG
GAGGGTCAGCGGGAGCGGGAGGGGGAGGGGGAGGGGTGGGGCCGCGTCGCCGATGGGTGT
CACCTTCAAGGCCGTGCCGCTCCAGTCGCCGCTGCCGCCCGTCGAGGAAATAATGTCCTT
CATTAGGTCATATGTTGTACCTGAAGGCTTTCCGGATAGTGTCACTCCTTCATATGTCCC
ATACATGACATGGAGAGCATTGAAGCATTTCTTTGGTGGAGCAATGGGTGTATTCACGAC
AAGAACCTTGCTAAACTCTGTTGGAGTTGCCCAAAGTAGGGCAACATCTGGAGCTGTGGC
TATCAACTGGATACTCAAGGATGGAGCTGGCCGAGTTGGAAAAATGCTTTTTGCCCGCCA
AGGGAAGAAATTTGACTACGACCTAAAGCAGCTTCGCTTTTCTGGCGATCTCTTGATGGA
GTTAGGAGCTGGGATAGAGTTAGCTACGGCAGCTTTCCCTCAACTTTTCCTACCTATGGC
TTGCATCGCAAATGTTGTTAAGAATGTTGCTGCTGTTACATCAACCTCGACCCGTACACC
AATCTACAAGGCATATGCAAAAGGAGAAAATATTGGAGATGTCACTGCCAAAGGAGAAAG
TGTTGGGAACATTGCTGATCTGTTGGGAACTGGTTTGAGCATTTTAATTTCTAAGAGGAA
TCCATCATTGGTGACTTCATTTGCCTTCTTGTCTTGTGGCTATCTCCTTAGTTCATACCA
TGAGGTGAGATCTGTTGTGCTGAACACTCTAAACACGGCAAGATTTACTGTGGCAGTTGA
TTCCTTCATTAAGAGCGGACATGTTCCCTCATTGAAGGAAGGAAACTCACAGGAGACTAT
ATTTAATCCACCATGGCGGCATCAGCCAGTTGCAATAGGATCAAGATTTGGAGAGGCATT
TCAGGAACCTGCTTCTTTTGTTGCCATAAGGCCTTTGTTTGAGGATGAGAGGTACATTGT
TACATATAACCCAACAAAGGACAAGGTATATGCTTTGCTCAAGGACCAAGCAAAGCCAGA
TGATATTCTCAAAGCCGCTTTCCATGCACATGTATTACTACATTTTATTAATGCATCACA
TGCTAACTTGAATGCACGGAAGCGGATGAACTCCAATCGGTCATACCAAAATGCAAACCC
ACTGAACATGGACTTTATACCACACATTGCTGAATCTTGCAAGATTGTCACTTCATCATA
TGGAGTTTTCAAGAAGAAAGCGAGGGAACAGGGATGGATAATGTCAGAATCATTGCTTAA
CCCTGGACGAGCTCGGTTGTGTGGAATAGTACCTCAATGACCCAATAATATTCGTTTGTT
ATAGTTGAATGGATGGTACAATTTTTTTTCATACATCGAATTCGGGCCCTATGTGAGTCA
GCGAACTTCTTTAACTAAATCAACCATATCGAAGTGAAGTACCTGGCATGCACCGCGCGA
GACAGGATGGATGGGTACTTCAACTTTGGAGCGATGTGCAACATCATGGGGTATGCTGAC
TCATGGAAAGACGGGGAAGGAAGGAGAAACTAACCAAAAAAAATACTGGACTAACAAGCT
TCTTGTATATCTATCTCACTATCTGTATTTAGTACTCTGTATAATGAGACGGGTATCCGC
CATATAGTCGTCGGTGTATGTATTGACCGACCTAGTTTTTGTTTCGACTCTACTTTCATT
GTTTCGGCTAACTTCGCGAATCTGTTGGTGTTTGTAAATGCCAGTTTTTCCATAAAGAAG
AGCTCTGTTTGTTTCC

CDS

1248 bp

>Os05t0419200-01 Protein of unknown function DUF647 family protein.
ATGGGTGTCACCTTCAAGGCCGTGCCGCTCCAGTCGCCGCTGCCGCCCGTCGAGGAAATA
ATGTCCTTCATTAGGTCATATGTTGTACCTGAAGGCTTTCCGGATAGTGTCACTCCTTCA
TATGTCCCATACATGACATGGAGAGCATTGAAGCATTTCTTTGGTGGAGCAATGGGTGTA
TTCACGACAAGAACCTTGCTAAACTCTGTTGGAGTTGCCCAAAGTAGGGCAACATCTGGA
GCTGTGGCTATCAACTGGATACTCAAGGATGGAGCTGGCCGAGTTGGAAAAATGCTTTTT
GCCCGCCAAGGGAAGAAATTTGACTACGACCTAAAGCAGCTTCGCTTTTCTGGCGATCTC
TTGATGGAGTTAGGAGCTGGGATAGAGTTAGCTACGGCAGCTTTCCCTCAACTTTTCCTA
CCTATGGCTTGCATCGCAAATGTTGTTAAGAATGTTGCTGCTGTTACATCAACCTCGACC
CGTACACCAATCTACAAGGCATATGCAAAAGGAGAAAATATTGGAGATGTCACTGCCAAA
GGAGAAAGTGTTGGGAACATTGCTGATCTGTTGGGAACTGGTTTGAGCATTTTAATTTCT
AAGAGGAATCCATCATTGGTGACTTCATTTGCCTTCTTGTCTTGTGGCTATCTCCTTAGT
TCATACCATGAGGTGAGATCTGTTGTGCTGAACACTCTAAACACGGCAAGATTTACTGTG
GCAGTTGATTCCTTCATTAAGAGCGGACATGTTCCCTCATTGAAGGAAGGAAACTCACAG
GAGACTATATTTAATCCACCATGGCGGCATCAGCCAGTTGCAATAGGATCAAGATTTGGA
GAGGCATTTCAGGAACCTGCTTCTTTTGTTGCCATAAGGCCTTTGTTTGAGGATGAGAGG
TACATTGTTACATATAACCCAACAAAGGACAAGGTATATGCTTTGCTCAAGGACCAAGCA
AAGCCAGATGATATTCTCAAAGCCGCTTTCCATGCACATGTATTACTACATTTTATTAAT
GCATCACATGCTAACTTGAATGCACGGAAGCGGATGAACTCCAATCGGTCATACCAAAAT
GCAAACCCACTGAACATGGACTTTATACCACACATTGCTGAATCTTGCAAGATTGTCACT
TCATCATATGGAGTTTTCAAGAAGAAAGCGAGGGAACAGGGATGGATAATGTCAGAATCA
TTGCTTAACCCTGGACGAGCTCGGTTGTGTGGAATAGTACCTCAATGA

Protein

416 aa

>Os05t0419200-01 Protein of unknown function DUF647 family protein.
MGVTFKAVPLQSPLPPVEEIMSFIRSYVVPEGFPDSVTPSYVPYMTWRALKHFFGGAMGV
FTTRTLLNSVGVAQSRATSGAVAINWILKDGAGRVGKMLFARQGKKFDYDLKQLRFSGDL
LMELGAGIELATAAFPQLFLPMACIANVVKNVAAVTSTSTRTPIYKAYAKGENIGDVTAK
GESVGNIADLLGTGLSILISKRNPSLVTSFAFLSCGYLLSSYHEVRSVVLNTLNTARFTV
AVDSFIKSGHVPSLKEGNSQETIFNPPWRHQPVAIGSRFGEAFQEPASFVAIRPLFEDER
YIVTYNPTKDKVYALLKDQAKPDDILKAAFHAHVLLHFINASHANLNARKRMNSNRSYQN
ANPLNMDFIPHIAESCKIVTSSYGVFKKKAREQGWIMSESLLNPGRARLCGIVPQ*

5'UTR

chr05:20553116..20553184 (- strand) : 69 bp

chr05:20552772..20552874 (- strand) : 103 bp

CDS

chr05:20552718..20552771 (- strand) : 54 bp

chr05:20551669..20551767 (- strand) : 99 bp

chr05:20551474..20551587 (- strand) : 114 bp

chr05:20551135..20551206 (- strand) : 72 bp

chr05:20550936..20551046 (- strand) : 111 bp

chr05:20550683..20550802 (- strand) : 120 bp

chr05:20550393..20550494 (- strand) : 102 bp

chr05:20550229..20550301 (- strand) : 73 bp

chr05:20549797..20549877 (- strand) : 81 bp

chr05:20549646..20549710 (- strand) : 65 bp

chr05:20549437..20549538 (- strand) : 102 bp

chr05:20549154..20549339 (- strand) : 186 bp

chr05:20548949..20549017 (- strand) : 69 bp

3'UTR

chr05:20548781..20548948 (- strand) : 168 bp

chr05:20548402..20548689 (- strand) : 288 bp

FASTA

>Os05t0419200-01 class=Sequence position=chr05:20548402..20553184 (- strand)
GAGTGCCTCG CTGTTTCGCC GCACCCATCG AAATCTCACC CGCTCTCTCT CTCTCGCGCG CGCGCCGCCC ACCCACCGCC
GCACCGGAGA TGGCGCCGGC GATGGGGATG AAGCGGCCGC CGGCGGCGGC GGCGGCGACG GCCACGCAGA CCGTCACGCT
TCCTGCGCCG GACGCGCGGG CGGCGGTGCG GGACGCGGTG CGCGTCGCCG TGCGGGAGGC CGAGCCGCCG CAGGCCCCGG
CGCTGCCGCC GAGGGCGCCC GCGCCGGCGG TCGCGGTGGA CGGGGTGCTG TGCCTGGAGG AGGTGGACGG GAGGAAGTGG
AGCTACGTGG TGGAGGGGGG CGCGTCCCCC GGGAAGGCCG GGAGGGTCAG CGGGAGCGGG AGGGGGAGGG GGAGGGGTGG
GGCCGCGTCG CCGATGGGTG TCACCTTCAA GGCCGTGCCG CTCCAGTCGC CGCTGCCGCC CGTCGAGGTG AGGGCGGGGT
GAGGCCCGTA GGGATCTATG GGGATTGGTG GCATTCGTGG TGTTTTTTGG TGTTGGGATT TCGATTCCAT GGTTGCGACC
CACCCGTAGG GAGATCTGAT TTGGAGTGAA ATGATGCGTT CTTTCGTCCT TTTTTTTTAT GGCTATGTTG TTGTTTCGGC
GATTGGTTCG TTCCTCGGTG ATAAATTGAA TGTTTCGTGG GCGGTAACAT CTCCTGATTT GTAGTTAGTT TGGTTTGATG
GGATGCGGAA AAAGCATGGT TTAAGCGGAT TTTCTCTCGT TAACAGTTGT AGTGTTTGAT GGGGGTGAGA TTTGCAGCTC
TGTTGGTCCT GACTCCTGAG TGCAAAATTG GATCCAGAAT TGTTGGCTCT GACCCTTCAA TGCAAAATTG GATCCAGAAT
TGTAGGCTGT GGTGTTGATT TGTTAACAAA CAACCCGGGA ATTAAAAGTT ATGCCGTTTG CTTTTGCCTG TTTTTGGCTG
TGTGGAGGCA ATTAGTGAAA TTCAGGGGGA TGTTTTCATG TATTTTTTCC CAGGTTCACA AGCTGTTCAC CCACGATTTA
ATTTTTTTTT CAGTTCAGCG ATTAAAATTC TTATCATGGG TCTGCAGGTT TAATTTGTCT CAGTTTGGGA ACTGCAGGTG
TTGTAGTTTT GCGCTACTCC ATGTTTGATT TATGGCTATT AGTTGAGGTC CTTTGCTGTT GAAGCTAAGT TGCAATTTTT
TTAGAAAAGT GATGCTTGTG ACTCTTTAGA GCTACTTGTT CGTTGGATGG TTCTTAATAG CACTTGTTTC TTTTGTTTAC
ATTCTCTTGG TGCCAACTGT TATGTTCTTC CCCTAGTTTG TTCTACTAAA ATATTAGGTG CATCTGCTAT GATCTTCTGG
AATGACATGG CAATGAGTGA TGAACTACGA AATGATTTTT AAACTTTTCT GTTGCAGGAA ATAATGTCCT TCATTAGGTC
ATATGTTGTA CCTGAAGGCT TTCCGGATAG TGTCACTCCT TCATATGTCC CATACATGAC ATGGAGAGCA TTGAAGGTGT
ATTTTCTGGA CATGACTTGG ATTATTATCA CTGTTGACTG TATTATCTTG CTAAATCCCT ACTATTTCTC TTTTTAGCAT
TTCTTTGGTG GAGCAATGGG TGTATTCACG ACAAGAACCT TGCTAAACTC TGTTGGAGTT GCCCAAAGTA GGGCAACATC
TGGAGCTGTG GCTATCAACT GGATACTCAA GGTAAAAATG GTTTTTGGCT AGAACAACAT AGAGAATAAG AATGGCCTTT
CTTCAACCTG CCTAGCTTGC TATCTAGCTT GACTAATAGT TGATGTGGCA CTAAACATTA TCAGTACCCA CTGACTAGAT
ATCACCCTGC TACCTGCCTA GCGCGTAGTG CCTTAGTGAT ACCAGTGACC TACTCAGTAT GATTTAGTTT CTAAGTGCTG
ATGTGTTCAT ATTAACCTTT TGTGATTGTG CTATTCTCTG ATAGTTTCAT TCCTACAGGA TGGAGCTGGC CGAGTTGGAA
AAATGCTTTT TGCCCGCCAA GGGAAGAAAT TTGACTACGA CCTAAAGCAG GTGCAATATT TGGAATCCAT GTTTTGCAAT
TATTTTGAGC TTTATTTTGC TCTATGCAAA AAACTGATCG AAAACACTTT CACTTCAGCT TCGCTTTTCT GGCGATCTCT
TGATGGAGTT AGGAGCTGGG ATAGAGTTAG CTACGGCAGC TTTCCCTCAA CTTTTCCTAC CTATGGCTTG CATCGCAAAT
GTTGTTAAGG TTTGACCTAG CGGTTTACTG TGACGAGTCC TAACATTAAT ATGGCTTGTT TGATAAAGTT ACTGTAATGA
ACCCTTTTTG TACCTGCAAA TGTACTGAAG ATTGTTCTAC TTGATGAAAT TGTTACATTC AGAATGTTGC TGCTGTTACA
TCAACCTCGA CCCGTACACC AATCTACAAG GCATATGCAA AAGGAGAAAA TATTGGAGAT GTCACTGCCA AAGGAGAAAG
TGTTGGGAAC ATTGCTGATC TGGTAATCAT TCATCTTTTG CATTTTGTTT CTTGTTGGTC TGGTTACCAT ACATGTAGCT
TATATATTCT GCTGGCATCA TTTATGTTAA TAGTATGCTG GCTACTAAAA TTTGTCTTAT TCAGTACTGC ACTTATATGA
AAATTTGCAT TCAATAGTTC ACTGATATTT CTGTCTTTTT ATGTGTGAAG TTGGGAACTG GTTTGAGCAT TTTAATTTCT
AAGAGGAATC CATCATTGGT GACTTCATTT GCCTTCTTGT CTTGTGGCTA TCTCCTTAGT TCATACCATG AGGTTTGCTT
TTGAACTTTC TTGATGCTCT TATAATTAAA TCATTCTGAT AAAAGTTATT GGTTAACCAA TCAAATATTA TATGTATTCT
CAGGTGAGAT CTGTTGTGCT GAACACTCTA AACACGGCAA GATTTACTGT GGCAGTTGAT TCCTTCATTA AGAGCGGTAT
GCAACTTTGA CTTCTAGAGT CATTCAGACT TTGTAATTTG CAATAGGAGA AAAGTTTGTA GTTGTGTATA CTGCTGCACC
TTGAAATACA ATGTGAAGCA TCATCCTTAA GAAGTTCAGA TGGCGCAACT AAATGTTCTG GATGCCACAG ATAGATTTAA
GAATGAATGG CAGACATAGT TGAAGACATT TATCAATATT CAATCTGCAC ATATTGTTTG AATAAAATGT GGAATGTGGA
ATTGCTTGAG CAACATATCG CAAAGAACTG TATTCATTTT AAAAGAAGTC CATGAAAAGT TGCAGTATTC AGTCTAATAT
TTGGATTCTC CATATCTATT GATGCAGGAC ATGTTCCCTC ATTGAAGGAA GGAAACTCAC AGGAGACTAT ATTTAATCCA
CCATGGCGGC ATCAGCCAGT TGCAATAGGT TTGCATCTAT AATTAAAGAT TTTTATGTAT TTTTTCATTC ATGCAGATTT
TAGAGCCTTT TTATAATCAA TTTTGATCTT ATAGGATCAA GATTTGGAGA GGCATTTCAG GAACCTGCTT CTTTTGTTGC
CATAAGGCCT TTGTTTGAGG TACTATCTCG ATGATGTTAT TAGTATTTGT CCTTAGACTG TTCTTTTCCT TCATTAGCAC
AATAGAGCAT TGGCATGTGT GAAGTTGTGA TATATTTTAA TTGTAGGATG AGAGGTACAT TGTTACATAT AACCCAACAA
AGGACAAGGT ATATGCTTTG CTCAAGGACC AAGCAAAGCC AGATGATATT CTCAAAGCCG CTTTCCATGT AAGTATTGAT
AACAAGGTTA ACAACTTTGG CAATGCCATA CTGGTCAAAT TTGTTTGCAT TATATCATCC TAATCAAATG TGTTTTGGTT
TACAGGCACA TGTATTACTA CATTTTATTA ATGCATCACA TGCTAACTTG AATGCACGGA AGCGGATGAA CTCCAATCGG
TCATACCAAA ATGCAAACCC ACTGAACATG GACTTTATAC CACACATTGC TGAATCTTGC AAGATTGTCA CTTCATCATA
TGGAGTTTTC AAGAAGAAAG CGAGGGAACA GGTGAAACCG CACCACCTTT ATCATTTACA TTTTGTACCT GGTTTGGGCT
GAACTACTAG TGAATAACAA TTCCGACAAA AACATGGCAT GATTCTCGTT GTATGGCATA ACTAACGACT CATTTTCTGA
TTCGCAGGGA TGGATAATGT CAGAATCATT GCTTAACCCT GGACGAGCTC GGTTGTGTGG AATAGTACCT CAATGACCCA
ATAATATTCG TTTGTTATAG TTGAATGGAT GGTACAATTT TTTTTCATAC ATCGAATTCG GGCCCTATGT GAGTCAGCGA
ACTTCTTTAA CTAAATCAAC CATATCGAAG TGAAGTACCT GGCATGCACC GCGCGAGACA GGATGGATGG GTACTTCAAC
TTTGGTTAGT GCTCTCTTGA TGTGAAACTA TGAACATTGT TACCGAACCG TTAAGCATAT TTTTCTTACT CGTTTTATTT
ATACCTGTTC TGCAGGAGCG ATGTGCAACA TCATGGGGTA TGCTGACTCA TGGAAAGACG GGGAAGGAAG GAGAAACTAA
CCAAAAAAAA TACTGGACTA ACAAGCTTCT TGTATATCTA TCTCACTATC TGTATTTAGT ACTCTGTATA ATGAGACGGG
TATCCGCCAT ATAGTCGTCG GTGTATGTAT TGACCGACCT AGTTTTTGTT TCGACTCTAC TTTCATTGTT TCGGCTAACT
TCGCGAATCT GTTGGTGTTT GTAAATGCCA GTTTTTCCAT AAAGAAGAGC TCTGTTTGTT TCC

Locus: Os05g0419200

Loading...

Locus: Os05g0419200

Loading...