Os05t0419200-02

Locus

Os05g0419200

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RUS6B

CGSNL Gene Name

ROOT UV-B SENSITIVE 6B

Oryzabase Gene Symbol Synonym(s)

OsRUS6B

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK119214 (DDBJ, Best hit)

Protein Evidence

NP_568713.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Protein of unknown function DUF647 (IPR006968)

Full-length cDNA

001-041-E08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0419200-02)

RiceXPro (AK119214)

Others

Oryzabase (21452)

KEGG (Os05t0419200-02)

Transcript

1135 bp

>Os05t0419200-02 Similar to predicted protein.
GTTGGGAACTGGTTTGAGCATTTTAATTTCTAAGAGGAATCCATCATTGGTGACTTCATT
TGCCTTCTTGTCTTGTGGCTATCTCCTTAGTTCATACCATGAGGTGAGATCTGTTGTGCT
GAACACTCTAAACACGGCAAGATTTACTGTGGCAGTTGATTCCTTCATTAAGAGCGGACA
TGTTCCCTCATTGAAGGAAGGAAACTCACAGGAGACTATATTTAATCCACCATGGCGGCA
TCAGCCAGTTGCAATAGGATCAAGATTTGGAGAGGCATTTCAGGAACCTGCTTCTTTTGT
TGCCATAAGGCCTTTGTTTGAGGATGAGAGGTACATTGTTACATATAACCCAACAAAGGA
CAAGGTATATGCTTTGCTCAAGGACCAAGCAAAGCCAGATGATATTCTCAAAGCCGCTTT
CCATGCACATGTATTACTACATTTTATTAATGCATCACATGCTAACTTGAATGCACGGAA
GCGGATGAACTCCAATCGGTCATACCAAAATGCAAACCCACTGAACATGGACTTTATACC
ACACATTGCTGAATCTTGCAAGATTGTCACTTCATCATATGGAGTTTTCAAGAAGAAAGC
GAGGGAACAGGGATGGATAATGTCAGAATCATTGCTTAACCCTGGACGAGCTCGGTTGTG
TGGAATAGTACCTCAATGACCCAATAATATTCGTTTGTTATAGTTGAATGGATGGTACAA
TTTTTTTTCATACATCGAATTCGGGCCCTATGTGAGTCAGCGAACTTCTTTAACTAAATC
AACCATATCGAAGTGAAGTACCTGGCATGCACCGCGCGAGACAGGATGGATGGGTACTTC
AACTTTGGAGCGATGTGCAACATCATGGGGTATGCTGACTCATGGAAAGACGGGGAAGGA
AGGAGAAACTAACCAAAAAAAATACTGGACTAACAAGCTTCTTGTATATCTATCTCACTA
TCTGTATTTAGTACTCTGTATAATGAGACGGGTATCCGCCATATAGTCGTCGGTGTATGT
ATTGACCGACCTAGTTTTTGTTTCGACTCTACTTTCATTGTTTCGGCTAACTTCGCGAAT
CTGTTGGTGTTTGTAAATGCCAGTTTTTCCATAAAGAAGAGCTCTGTTTGTTTCC

CDS

678 bp

>Os05t0419200-02 Similar to predicted protein.
TTGGGAACTGGTTTGAGCATTTTAATTTCTAAGAGGAATCCATCATTGGTGACTTCATTT
GCCTTCTTGTCTTGTGGCTATCTCCTTAGTTCATACCATGAGGTGAGATCTGTTGTGCTG
AACACTCTAAACACGGCAAGATTTACTGTGGCAGTTGATTCCTTCATTAAGAGCGGACAT
GTTCCCTCATTGAAGGAAGGAAACTCACAGGAGACTATATTTAATCCACCATGGCGGCAT
CAGCCAGTTGCAATAGGATCAAGATTTGGAGAGGCATTTCAGGAACCTGCTTCTTTTGTT
GCCATAAGGCCTTTGTTTGAGGATGAGAGGTACATTGTTACATATAACCCAACAAAGGAC
AAGGTATATGCTTTGCTCAAGGACCAAGCAAAGCCAGATGATATTCTCAAAGCCGCTTTC
CATGCACATGTATTACTACATTTTATTAATGCATCACATGCTAACTTGAATGCACGGAAG
CGGATGAACTCCAATCGGTCATACCAAAATGCAAACCCACTGAACATGGACTTTATACCA
CACATTGCTGAATCTTGCAAGATTGTCACTTCATCATATGGAGTTTTCAAGAAGAAAGCG
AGGGAACAGGGATGGATAATGTCAGAATCATTGCTTAACCCTGGACGAGCTCGGTTGTGT
GGAATAGTACCTCAATGA

Protein

226 aa

>Os05t0419200-02 Similar to predicted protein.
LGTGLSILISKRNPSLVTSFAFLSCGYLLSSYHEVRSVVLNTLNTARFTVAVDSFIKSGH
VPSLKEGNSQETIFNPPWRHQPVAIGSRFGEAFQEPASFVAIRPLFEDERYIVTYNPTKD
KVYALLKDQAKPDDILKAAFHAHVLLHFINASHANLNARKRMNSNRSYQNANPLNMDFIP
HIAESCKIVTSSYGVFKKKAREQGWIMSESLLNPGRARLCGIVPQ*

5'UTR

chr05:20550495..20550495 (- strand) : 1 bp

CDS

chr05:20550393..20550494 (- strand) : 102 bp

chr05:20550229..20550301 (- strand) : 73 bp

chr05:20549797..20549877 (- strand) : 81 bp

chr05:20549646..20549710 (- strand) : 65 bp

chr05:20549437..20549538 (- strand) : 102 bp

chr05:20549154..20549339 (- strand) : 186 bp

chr05:20548949..20549017 (- strand) : 69 bp

3'UTR

chr05:20548781..20548948 (- strand) : 168 bp

chr05:20548402..20548689 (- strand) : 288 bp

FASTA

>Os05t0419200-02 class=Sequence position=chr05:20548402..20550495 (- strand)
GTTGGGAACT GGTTTGAGCA TTTTAATTTC TAAGAGGAAT CCATCATTGG TGACTTCATT TGCCTTCTTG TCTTGTGGCT
ATCTCCTTAG TTCATACCAT GAGGTTTGCT TTTGAACTTT CTTGATGCTC TTATAATTAA ATCATTCTGA TAAAAGTTAT
TGGTTAACCA ATCAAATATT ATATGTATTC TCAGGTGAGA TCTGTTGTGC TGAACACTCT AAACACGGCA AGATTTACTG
TGGCAGTTGA TTCCTTCATT AAGAGCGGTA TGCAACTTTG ACTTCTAGAG TCATTCAGAC TTTGTAATTT GCAATAGGAG
AAAAGTTTGT AGTTGTGTAT ACTGCTGCAC CTTGAAATAC AATGTGAAGC ATCATCCTTA AGAAGTTCAG ATGGCGCAAC
TAAATGTTCT GGATGCCACA GATAGATTTA AGAATGAATG GCAGACATAG TTGAAGACAT TTATCAATAT TCAATCTGCA
CATATTGTTT GAATAAAATG TGGAATGTGG AATTGCTTGA GCAACATATC GCAAAGAACT GTATTCATTT TAAAAGAAGT
CCATGAAAAG TTGCAGTATT CAGTCTAATA TTTGGATTCT CCATATCTAT TGATGCAGGA CATGTTCCCT CATTGAAGGA
AGGAAACTCA CAGGAGACTA TATTTAATCC ACCATGGCGG CATCAGCCAG TTGCAATAGG TTTGCATCTA TAATTAAAGA
TTTTTATGTA TTTTTTCATT CATGCAGATT TTAGAGCCTT TTTATAATCA ATTTTGATCT TATAGGATCA AGATTTGGAG
AGGCATTTCA GGAACCTGCT TCTTTTGTTG CCATAAGGCC TTTGTTTGAG GTACTATCTC GATGATGTTA TTAGTATTTG
TCCTTAGACT GTTCTTTTCC TTCATTAGCA CAATAGAGCA TTGGCATGTG TGAAGTTGTG ATATATTTTA ATTGTAGGAT
GAGAGGTACA TTGTTACATA TAACCCAACA AAGGACAAGG TATATGCTTT GCTCAAGGAC CAAGCAAAGC CAGATGATAT
TCTCAAAGCC GCTTTCCATG TAAGTATTGA TAACAAGGTT AACAACTTTG GCAATGCCAT ACTGGTCAAA TTTGTTTGCA
TTATATCATC CTAATCAAAT GTGTTTTGGT TTACAGGCAC ATGTATTACT ACATTTTATT AATGCATCAC ATGCTAACTT
GAATGCACGG AAGCGGATGA ACTCCAATCG GTCATACCAA AATGCAAACC CACTGAACAT GGACTTTATA CCACACATTG
CTGAATCTTG CAAGATTGTC ACTTCATCAT ATGGAGTTTT CAAGAAGAAA GCGAGGGAAC AGGTGAAACC GCACCACCTT
TATCATTTAC ATTTTGTACC TGGTTTGGGC TGAACTACTA GTGAATAACA ATTCCGACAA AAACATGGCA TGATTCTCGT
TGTATGGCAT AACTAACGAC TCATTTTCTG ATTCGCAGGG ATGGATAATG TCAGAATCAT TGCTTAACCC TGGACGAGCT
CGGTTGTGTG GAATAGTACC TCAATGACCC AATAATATTC GTTTGTTATA GTTGAATGGA TGGTACAATT TTTTTTCATA
CATCGAATTC GGGCCCTATG TGAGTCAGCG AACTTCTTTA ACTAAATCAA CCATATCGAA GTGAAGTACC TGGCATGCAC
CGCGCGAGAC AGGATGGATG GGTACTTCAA CTTTGGTTAG TGCTCTCTTG ATGTGAAACT ATGAACATTG TTACCGAACC
GTTAAGCATA TTTTTCTTAC TCGTTTTATT TATACCTGTT CTGCAGGAGC GATGTGCAAC ATCATGGGGT ATGCTGACTC
ATGGAAAGAC GGGGAAGGAA GGAGAAACTA ACCAAAAAAA ATACTGGACT AACAAGCTTC TTGTATATCT ATCTCACTAT
CTGTATTTAG TACTCTGTAT AATGAGACGG GTATCCGCCA TATAGTCGTC GGTGTATGTA TTGACCGACC TAGTTTTTGT
TTCGACTCTA CTTTCATTGT TTCGGCTAAC TTCGCGAATC TGTTGGTGTT TGTAAATGCC AGTTTTTCCA TAAAGAAGAG
CTCTGTTTGT TTCC

Locus: Os05g0419200

Loading...

Locus: Os05g0419200

Loading...