Os05t0428700-01

Locus

Os05g0428700

Description

Potassium channel, Shaker K+ channel

RAP-DB Gene Symbol Synonym(s)

OsAKT2, OsK3.1

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

AKT2

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsAKT2, ZMK2, OsZMK2

Oryzabase Gene Name Synonym(s)

salt-sensitive K1 uptake channel OsAKT2, Potassium channel protein ZMK2

Transcript Evidence

AK061594 (truncated)

JN989970

Protein Evidence

Q75HP9

Literature

PMID: 32128922

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

March 6, 2020

Gene Ontology (GO)

Biological Process: ion transport (GO:0006811)

Biological Process: potassium ion transport (GO:0006813)

Biological Process: transmembrane transport (GO:0055085)

Molecular Function: ion channel activity (GO:0005216)

Molecular Function: voltage-gated potassium channel activity (GO:0005249)

Molecular Function: protein binding (GO:0005515)

Cellular Component: membrane (GO:0016020)

Functional domain (InterPro)

Cyclic nucleotide-binding-like (IPR018490)

RmlC-like jelly roll fold (IPR014710)

Ankyrin repeat-containing domain superfamily (IPR036770)

Potassium channel, voltage-dependent, EAG/ELK/ERG (IPR003938)

Ion transport domain (IPR005821)

Cyclic nucleotide-binding domain (IPR000595)

Ankyrin repeat-containing domain (IPR020683)

KHA domain (IPR021789)

Ankyrin repeat (IPR002110)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

001-023-E11(truncated) (Online Clone Ordering)

Expression Databases

TENOR (Os05t0428700-01)

RiceXPro (AK061594)

Others

Oryzabase (10370)

KEGG (Os05t0428700-01)

Transcript

2724 bp

>Os05t0428700-01 Potassium channel, Shaker K+ channel
ATGAAGACCTCGAGCTTCGAGAGCGCTAGTAGCAGCGGCGGCAGCGGCGGTGGCGGTGGC
GGCGGTGGCGGCGAGGGCTCCGGCTCGTTCAACCTCCGGAACCTATCCAAGCTCATCCTG
CCGCCTCTCGGCGTGCCGGCCGGCGGCCACGCCCAGTCCGGCCATGCCGGCCCCAACGAC
AGGCGTGTCATCTCGCCTCTCGACTCCAGATACAGGTGCTGGGACACGTTCATGGTGGTG
CTGGTGGCGTACTCGGCGTGGGTGTACCCGTTCGAGGTGGCGTTCATGAACGCGTCGCCC
AAGGGCGGCCTCGAGGTGGCCGACATCGTCGTCGACCTCTTCTTCGCCGTCGACATCGTC
CTCACCTTCTTCGTCGCCTACATCGACTCCAGGACTCAGCTCCTCGTCCGCGACAGGCGG
AGGATTGCCACCAGATATCTGTCGACGTTCTTCATCATGGATGTGGCGTCGACTATCCCG
TTCCAAGGCCTTGCCTACATCGTCACCGGCGAGGTCAGGGAGAGCCCGGCGTTCAGCCTC
CTCGGCATCCTCCGGCTATGGCGTCTCAGGAAGGTCAAGCAGTTCTTCACAAGGCTGGAG
AAGGACATCAGGTTCAACTACTTCTGGATCCGCTGCGCCCGGCTCATCGCGGTGACGCTG
TTCCTGGTGCACTGCGCGGGGTGCCTGTACTACCTGATCGCGGACAGGTACCCGCACAGG
GAGAAGACGTGGATCGGCGCGGTGATCCCGGACTTCCAGGAGGCGAGCCTGTGGATCCGC
TACACCTCCTCCGTCTACTGGTCCATCACCACCATGACCACCGTCGGCTACGGCGACATG
CACGCCCAGAACACCGTCGAGATGATCTTCAACATCTTCTACATGCTCTTCAACCTCGGC
CTCACCGCCTACCTCATCGGCAACATGACCAACCTCGTCGTTGAGGGCACCCGCCGTACC
ATGGAATTCAGGAACAGCATTCGTGCTGCCTCCAATTTCGTGGGCCGGAACCACCTGCCG
CCTAGGCTGAAGCAGCAGATACTGGCCTACATGTGCCTCAAGTTCAGGGCAGAGAGCCTG
AACCAGCAGCAGCTGATGGATCAGCTCCCCAAATCCATCTGCAAGGGCATCTGCGAGTAC
CTCTTCCTCCCCGTCGTCAAGGACGTCTACCTCTTCAAGGGTGTCTCAAGAGAAGTGCTC
CTTCTCATGGTTACGAAGATGAAGCCGGAGTACATACCGCCGAAGGAGGACGTGATCGTG
CAGAACGAGGCGCCGGACGACGTCTACATCGTGGTGTCCGGCGAGGTGGAGGTGATCTAC
TCCGACGGCGAAGCCGAGGAGCGGGTGGTGGCGACGCTGGGGACGAGGGGCGTGTTCGGC
GAGGTGAGCGCGCTCAGCGACCGCCCGCAGAGCTTCACGCTGCGGACGCGGACGCTGTGC
CAGCTGCTGCGCCTGCGCCAGGCCGCGCTCAAGGAGGCCATGCAGAGCAAGCCCGAGGAC
AGCGTCGTCATCATCAAGAACTTCCTCAAGCATCAGATCGAGATGCACGACATGAAGGTG
GAGGACTTGCTCGGGGAGGACGCCGCCGGCGAGTACGACCACGGCAACATACCGTGCAAT
CTGCTGACGGTGGCAGCCACCGGGAACAGCAGCTTCCTTGAGGATCTCCTGAAAGTTGGA
ATGGATCCTGACGTCGGTGACTCCAAGGGAAGAACTGCACTGCATATAGCGGCATCGAAG
GGGTACGAGGACTGCGTGCTGGTTCTCCTCAAGCAAGCGTGCAACGTAAACATCAAAGAC
GCGCAGGGCAACACGGCGCTGTGGAACGCCATCGCCGCGAGGCACCACAAGATCTTCAAC
ATCCTGTACCACTTCGCGCGCGTCTCGAGCCCGCACCACGCCGCCGGCGACCTCCTCTGC
CTCGCCGCGCGCCGGGGCGACCTCGACACGCTCCGGGAGCTCCTCAAGCACGGCCTCGCC
GTCGACTCGGAGGACCGGGACGGCGCCACGGCGCTCCGCGTCGCGCTCGCCGAGGGCCAC
GCCGACGTCGCCAGGCTCCTCGTCCTCAACGGCGCCAGCGTCGACAGGGCGGCCAGCCAC
AACGAGCAGCAGGCGGCGGCGGCGGTGTCGGTCGACGAGCTGCGGGAGCTCATGAAGACG
CGCGAGCTCGCGCACCCGGTCACCATCGTCGTCGACTCGCCGTCGCCGGCCGCCGCAGCC
GTCATCCGGGAGGTCGGCTCGTCGGGGGACAGCCGGAATGGGCGGCGCCAGAGCGCGAGA
TCAGACGGCGCGCACTGGCCACGGGTGAGCATATACAGGGGCCATCCATTCGTCAGAAAC
CGTAGCTCAGAAGCCGGCAAGCTGATCAACCTGCCCGGCACCATGGAAGAATTCAGAATC
ATCATAGAGGAGAAACTGAAAGTCGACGCGAGGAAGACGCTGATCATGAACGACGAAGGA
GCGGAGATTGACTCGATCGACGTGATCCGGGACAACGATAAGCTGTTCATAGTGACCGAG
GAGCATATGACAGCAGTAGCATCGATGGACTCGGTGTCTGGATCATAGCATATTCGAGTT
TGCTGAATAAGGCCTTGTCCAGCTtggagggatttgagtgggaatgtttttgcatcacaa
taggtgtaaaactagtctccccaatctgttccttttaggattaaccgaacaaagccTAAT
CAAGTTTTCTATTGGCGACAATCC

CDS

2568 bp

>Os05t0428700-01 Potassium channel, Shaker K+ channel
ATGAAGACCTCGAGCTTCGAGAGCGCTAGTAGCAGCGGCGGCAGCGGCGGTGGCGGTGGC
GGCGGTGGCGGCGAGGGCTCCGGCTCGTTCAACCTCCGGAACCTATCCAAGCTCATCCTG
CCGCCTCTCGGCGTGCCGGCCGGCGGCCACGCCCAGTCCGGCCATGCCGGCCCCAACGAC
AGGCGTGTCATCTCGCCTCTCGACTCCAGATACAGGTGCTGGGACACGTTCATGGTGGTG
CTGGTGGCGTACTCGGCGTGGGTGTACCCGTTCGAGGTGGCGTTCATGAACGCGTCGCCC
AAGGGCGGCCTCGAGGTGGCCGACATCGTCGTCGACCTCTTCTTCGCCGTCGACATCGTC
CTCACCTTCTTCGTCGCCTACATCGACTCCAGGACTCAGCTCCTCGTCCGCGACAGGCGG
AGGATTGCCACCAGATATCTGTCGACGTTCTTCATCATGGATGTGGCGTCGACTATCCCG
TTCCAAGGCCTTGCCTACATCGTCACCGGCGAGGTCAGGGAGAGCCCGGCGTTCAGCCTC
CTCGGCATCCTCCGGCTATGGCGTCTCAGGAAGGTCAAGCAGTTCTTCACAAGGCTGGAG
AAGGACATCAGGTTCAACTACTTCTGGATCCGCTGCGCCCGGCTCATCGCGGTGACGCTG
TTCCTGGTGCACTGCGCGGGGTGCCTGTACTACCTGATCGCGGACAGGTACCCGCACAGG
GAGAAGACGTGGATCGGCGCGGTGATCCCGGACTTCCAGGAGGCGAGCCTGTGGATCCGC
TACACCTCCTCCGTCTACTGGTCCATCACCACCATGACCACCGTCGGCTACGGCGACATG
CACGCCCAGAACACCGTCGAGATGATCTTCAACATCTTCTACATGCTCTTCAACCTCGGC
CTCACCGCCTACCTCATCGGCAACATGACCAACCTCGTCGTTGAGGGCACCCGCCGTACC
ATGGAATTCAGGAACAGCATTCGTGCTGCCTCCAATTTCGTGGGCCGGAACCACCTGCCG
CCTAGGCTGAAGCAGCAGATACTGGCCTACATGTGCCTCAAGTTCAGGGCAGAGAGCCTG
AACCAGCAGCAGCTGATGGATCAGCTCCCCAAATCCATCTGCAAGGGCATCTGCGAGTAC
CTCTTCCTCCCCGTCGTCAAGGACGTCTACCTCTTCAAGGGTGTCTCAAGAGAAGTGCTC
CTTCTCATGGTTACGAAGATGAAGCCGGAGTACATACCGCCGAAGGAGGACGTGATCGTG
CAGAACGAGGCGCCGGACGACGTCTACATCGTGGTGTCCGGCGAGGTGGAGGTGATCTAC
TCCGACGGCGAAGCCGAGGAGCGGGTGGTGGCGACGCTGGGGACGAGGGGCGTGTTCGGC
GAGGTGAGCGCGCTCAGCGACCGCCCGCAGAGCTTCACGCTGCGGACGCGGACGCTGTGC
CAGCTGCTGCGCCTGCGCCAGGCCGCGCTCAAGGAGGCCATGCAGAGCAAGCCCGAGGAC
AGCGTCGTCATCATCAAGAACTTCCTCAAGCATCAGATCGAGATGCACGACATGAAGGTG
GAGGACTTGCTCGGGGAGGACGCCGCCGGCGAGTACGACCACGGCAACATACCGTGCAAT
CTGCTGACGGTGGCAGCCACCGGGAACAGCAGCTTCCTTGAGGATCTCCTGAAAGTTGGA
ATGGATCCTGACGTCGGTGACTCCAAGGGAAGAACTGCACTGCATATAGCGGCATCGAAG
GGGTACGAGGACTGCGTGCTGGTTCTCCTCAAGCAAGCGTGCAACGTAAACATCAAAGAC
GCGCAGGGCAACACGGCGCTGTGGAACGCCATCGCCGCGAGGCACCACAAGATCTTCAAC
ATCCTGTACCACTTCGCGCGCGTCTCGAGCCCGCACCACGCCGCCGGCGACCTCCTCTGC
CTCGCCGCGCGCCGGGGCGACCTCGACACGCTCCGGGAGCTCCTCAAGCACGGCCTCGCC
GTCGACTCGGAGGACCGGGACGGCGCCACGGCGCTCCGCGTCGCGCTCGCCGAGGGCCAC
GCCGACGTCGCCAGGCTCCTCGTCCTCAACGGCGCCAGCGTCGACAGGGCGGCCAGCCAC
AACGAGCAGCAGGCGGCGGCGGCGGTGTCGGTCGACGAGCTGCGGGAGCTCATGAAGACG
CGCGAGCTCGCGCACCCGGTCACCATCGTCGTCGACTCGCCGTCGCCGGCCGCCGCAGCC
GTCATCCGGGAGGTCGGCTCGTCGGGGGACAGCCGGAATGGGCGGCGCCAGAGCGCGAGA
TCAGACGGCGCGCACTGGCCACGGGTGAGCATATACAGGGGCCATCCATTCGTCAGAAAC
CGTAGCTCAGAAGCCGGCAAGCTGATCAACCTGCCCGGCACCATGGAAGAATTCAGAATC
ATCATAGAGGAGAAACTGAAAGTCGACGCGAGGAAGACGCTGATCATGAACGACGAAGGA
GCGGAGATTGACTCGATCGACGTGATCCGGGACAACGATAAGCTGTTCATAGTGACCGAG
GAGCATATGACAGCAGTAGCATCGATGGACTCGGTGTCTGGATCATAG

Protein

855 aa

>Os05t0428700-01 Potassium channel, Shaker K+ channel
MKTSSFESASSSGGSGGGGGGGGGEGSGSFNLRNLSKLILPPLGVPAGGHAQSGHAGPND
RRVISPLDSRYRCWDTFMVVLVAYSAWVYPFEVAFMNASPKGGLEVADIVVDLFFAVDIV
LTFFVAYIDSRTQLLVRDRRRIATRYLSTFFIMDVASTIPFQGLAYIVTGEVRESPAFSL
LGILRLWRLRKVKQFFTRLEKDIRFNYFWIRCARLIAVTLFLVHCAGCLYYLIADRYPHR
EKTWIGAVIPDFQEASLWIRYTSSVYWSITTMTTVGYGDMHAQNTVEMIFNIFYMLFNLG
LTAYLIGNMTNLVVEGTRRTMEFRNSIRAASNFVGRNHLPPRLKQQILAYMCLKFRAESL
NQQQLMDQLPKSICKGICEYLFLPVVKDVYLFKGVSREVLLLMVTKMKPEYIPPKEDVIV
QNEAPDDVYIVVSGEVEVIYSDGEAEERVVATLGTRGVFGEVSALSDRPQSFTLRTRTLC
QLLRLRQAALKEAMQSKPEDSVVIIKNFLKHQIEMHDMKVEDLLGEDAAGEYDHGNIPCN
LLTVAATGNSSFLEDLLKVGMDPDVGDSKGRTALHIAASKGYEDCVLVLLKQACNVNIKD
AQGNTALWNAIAARHHKIFNILYHFARVSSPHHAAGDLLCLAARRGDLDTLRELLKHGLA
VDSEDRDGATALRVALAEGHADVARLLVLNGASVDRAASHNEQQAAAAVSVDELRELMKT
RELAHPVTIVVDSPSPAAAAVIREVGSSGDSRNGRRQSARSDGAHWPRVSIYRGHPFVRN
RSSEAGKLINLPGTMEEFRIIIEEKLKVDARKTLIMNDEGAEIDSIDVIRDNDKLFIVTE
EHMTAVASMDSVSGS*

CDS

chr05:21044646..21044860 (- strand) : 215 bp

chr05:21044336..21044554 (- strand) : 219 bp

chr05:21043024..21043182 (- strand) : 159 bp

chr05:21042867..21042924 (- strand) : 58 bp

chr05:21042451..21042768 (- strand) : 318 bp

chr05:21042126..21042365 (- strand) : 240 bp

chr05:21041364..21041684 (- strand) : 321 bp

chr05:21040975..21041166 (- strand) : 192 bp

chr05:21040787..21040862 (- strand) : 76 bp

chr05:21039996..21040604 (- strand) : 609 bp

chr05:21039731..21039891 (- strand) : 161 bp

3'UTR

chr05:21039575..21039730 (- strand) : 156 bp

FASTA

>Os05t0428700-01 class=Sequence position=chr05:21039575..21044860 (- strand)
ATGAAGACCT CGAGCTTCGA GAGCGCTAGT AGCAGCGGCG GCAGCGGCGG TGGCGGTGGC GGCGGTGGCG GCGAGGGCTC
CGGCTCGTTC AACCTCCGGA ACCTATCCAA GCTCATCCTG CCGCCTCTCG GCGTGCCGGC CGGCGGCCAC GCCCAGTCCG
GCCATGCCGG CCCCAACGAC AGGCGTGTCA TCTCGCCTCT CGACTCCAGA TACAGGTCAG TGAGGGTGAC ACACCATCTC
TCACTCTTCG CGCATGCTTC GCCATGGCGC CATGGATCTC AGCTAGCTTG AGAGGAGGTT TTGTAGGTGC TGGGACACGT
TCATGGTGGT GCTGGTGGCG TACTCGGCGT GGGTGTACCC GTTCGAGGTG GCGTTCATGA ACGCGTCGCC CAAGGGCGGC
CTCGAGGTGG CCGACATCGT CGTCGACCTC TTCTTCGCCG TCGACATCGT CCTCACCTTC TTCGTCGCCT ACATCGACTC
CAGGACTCAG CTCCTCGTCC GCGACAGGCG GAGGATTGCC ACCAGGTAAT TCACGCACGT CTCACTGTCG ATCTCATCTC
AAATTTCATC ACCTAATATA AGCTTAGCTC GCAACATTTG GTAGAGTGCC ATGTTAATTA CTCTTGCTAT GCTTGTTTCA
GAAAACATGG CATGATCATA TTTTTGTCTA AAAATGGTTT TGCTCGTCCA TTATCCTTTT TGGTGAGAAA AATGGCAACT
GCATTACGTG GTGTTTAATA CGAGTCTAGT CTTAGTCGAG CTGCTGATTT TCTATTCTGA TCATTTACTG CCTGATGGGG
ATAGCTCGTG CCGTTAAGGC AAAGCCATCC GGCTGATCTT GTTCATGTGA AGTTCCATAC TAGCTGGTCG CTGACTCACT
GGTCGCTATA CATCAAGTAT TTATGACGAA TGCTGTGGTT TAATTTCCTA GTCGTGACTG TATGCTAGAG AAGTTTCATG
GCATACCTAA CGTGGCAACA CTTTGATCAT GGAATTAAAC ATCTGCTACA GGACATGTCA GTATACTATT ATCACCAAGA
AAAGGTCTTC AAATCAGAAC GGGACCCAAA ACCAAACTGC ATCATTAATA ACAATTTCTT TTATTTTTTA TGACTGCATT
ATTGATTTGA TAATAGTGCA ACTGGGCCCT ACATCGTACT GACTGAGATT TCTGAAGTTT TTTATGCAAA ACACGAGCAG
CTGTAGCAGT AGGTGCTGAG AAGTCGTGTG TCATGTGTGT GCAAGCTTCA GCATACGCCA AAATGGATAA TGTCGTGATC
AAATCTGTAG CGGGTTCTGT TTCCTTTGGG TGGATTATTA GAGATTCTTG TTAGCTACAT TATCTTTACA GATCAACGAT
AATGGTCCAT CAGAGAGATG TGCCCAAGAT AGCATCATTG ACATGCCCAC AGCTTTAGAA TTTCTGTTCC ACTGAAGTTT
GAAATGATTA GAGATGTTCA TTTTCTTTTC TTTTCTTTTC TTTTTCTTTT CTTTTTTGTT TCTTGCTATG TTTGGTCGTT
TTGATTTAAT TAACTAATGA AAATGGATCT CATCTTCAGC CTCTCTGCCG ACAGTCACCC AAGCAATAAG TTTTTTTTTG
GTTTTGAAAA AGAAAAAAAT ATTGGTCGTT TTGATTATTT GAACACTTAA GTGATGCAGA CTTGTTGTGC ATTCACAGAT
ATCTGTCGAC GTTCTTCATC ATGGATGTGG CGTCGACTAT CCCGTTCCAA GGCCTTGCCT ACATCGTCAC CGGCGAGGTC
AGGGAGAGCC CGGCGTTCAG CCTCCTCGGC ATCCTCCGGC TATGGCGTCT CAGGAAGGTC AAGCAGTTCT TCACAAGGTA
AAATAAACAG AGTTAAAAGC TATCATATGC GTGCCAATGG CACAGAAATA CACAAACGAA ATCTAACTGA CAACACGTAG
TTGATCGATC CATCAGGCTG GAGAAGGACA TCAGGTTCAA CTACTTCTGG ATCCGCTGCG CCCGGCTCAT CGCGGTAAAC
GCCATTTTGA TCTCTCAGGG AAAATGAAAT CTTTCAGCAA AATTAGGATG ACATTTTTTT TGTTGTCTGA AGATTGTGTG
AAACTTTTGC AGGTGACGCT GTTCCTGGTG CACTGCGCGG GGTGCCTGTA CTACCTGATC GCGGACAGGT ACCCGCACAG
GGAGAAGACG TGGATCGGCG CGGTGATCCC GGACTTCCAG GAGGCGAGCC TGTGGATCCG CTACACCTCC TCCGTCTACT
GGTCCATCAC CACCATGACC ACCGTCGGCT ACGGCGACAT GCACGCCCAG AACACCGTCG AGATGATCTT CAACATCTTC
TACATGCTCT TCAACCTCGG CCTCACCGCC TACCTCATCG GCAACATGAC CAACCTCGTC GTTGAGGGCA CCCGCCGTAC
CATGGAATTC GTAAGAATTC TTATTACTAA CCTGCATGTG TTTGTTGAGT TGCATGTACC GACCAGTTTA ATTACTCTTT
TTTTTTAACT TGTAGAGGAA CAGCATTCGT GCTGCCTCCA ATTTCGTGGG CCGGAACCAC CTGCCGCCTA GGCTGAAGCA
GCAGATACTG GCCTACATGT GCCTCAAGTT CAGGGCAGAG AGCCTGAACC AGCAGCAGCT GATGGATCAG CTCCCCAAAT
CCATCTGCAA GGGCATCTGC GAGTACCTCT TCCTCCCCGT CGTCAAGGAC GTCTACCTCT TCAAGGGTGT CTCAAGAGAA
GTGCTCCTTC TCATGGTAAC CACACACATT AACCATACTC AATTTTATTC AGACAAACAA tggatctgtt tagatcccac
ctcaaaattt tacaccatat cacattgaac gtttaaacac ctgcatgaag tatcaaatat aggttaaaaa aaattaatcg
cacagattgc aattactttg cgagacgaat cttttaatcc taattactcc atgatttgac aatgtggtgc tacagtaaac
atgcgctaat gacggattaa ttaggcttaa taaatttatc tcgcagttta atgacggata ctgtaattat tttttttgtt
agtgcccaaa caccccatgc aacaccctat ataacaaccg atgtgacaca tcaaaatttt acaccctgat ctaaacaccc
cCGAAGAGAA GAAGATTAGA CAAACAACAA TGAGGATGGA TTTAATTCGT GTGTAGGTTA CGAAGATGAA GCCGGAGTAC
ATACCGCCGA AGGAGGACGT GATCGTGCAG AACGAGGCGC CGGACGACGT CTACATCGTG GTGTCCGGCG AGGTGGAGGT
GATCTACTCC GACGGCGAAG CCGAGGAGCG GGTGGTGGCG ACGCTGGGGA CGAGGGGCGT GTTCGGCGAG GTGAGCGCGC
TCAGCGACCG CCCGCAGAGC TTCACGCTGC GGACGCGGAC GCTGTGCCAG CTGCTGCGCC TGCGCCAGGC CGCGCTCAAG
GAGGCCATGC AGAGCAAGCC CGAGGACAGC GTCGTCATCA TCAAGAACTT CCTCAAGGTC GGTGAACATG TACACCGTCG
TCTTTTTTTT TTCACGAACA CGCAAAAGAA TTGTACGAAT ACACATTAAT ATATTAGAAG AAAAAAAGTT TTAGTTACAC
AAATGTACAC CGTCGTCCCA CGGTGATCAG ACTCATCCAT GGATTGGATT CCGAGCAAAC TACTGAACTG AGATGTGTGG
TTTGTGGTGT GCAGCATCAG ATCGAGATGC ACGACATGAA GGTGGAGGAC TTGCTCGGGG AGGACGCCGC CGGCGAGTAC
GACCACGGCA ACATACCGTG CAATCTGCTG ACGGTGGCAG CCACCGGGAA CAGCAGCTTC CTTGAGGATC TCCTGAAAGT
TGGAATGGAT CCTGACGTCG GTGACTCCAA GGGAAGAACT GCACTGGTAA GGCTAGTACT GGGCCCTCTC GACCAAAAGA
ATACATTCAA ACTCTCAAAT TTAGACTTGA ATCCGAAATT TGAATCGAAT TTACTAATTT GGGCCCTGTT CTTGTCAGCA
TATAGCGGCA TCGAAGGGGT ACGAGGACTG CGTGCTGGTT CTCCTCAAGC AAGCGTGCAA CGTAAACATC AAAGGTAAAA
AACATCCCAA ATCTCGTAAT TAGCGTATCT CGtactccct ttgcctaaaa tataagaaca aaagattgga tgagacgttt
cctaatacta cgaatttgga taaacgtcat atccaatttt aaattcttgt attttaggac ggTGACAGGT TTGATCCTGT
GATGTGATTT CTGCAGACGC GCAGGGCAAC ACGGCGCTGT GGAACGCCAT CGCCGCGAGG CACCACAAGA TCTTCAACAT
CCTGTACCAC TTCGCGCGCG TCTCGAGCCC GCACCACGCC GCCGGCGACC TCCTCTGCCT CGCCGCGCGC CGGGGCGACC
TCGACACGCT CCGGGAGCTC CTCAAGCACG GCCTCGCCGT CGACTCGGAG GACCGGGACG GCGCCACGGC GCTCCGCGTC
GCGCTCGCCG AGGGCCACGC CGACGTCGCC AGGCTCCTCG TCCTCAACGG CGCCAGCGTC GACAGGGCGG CCAGCCACAA
CGAGCAGCAG GCGGCGGCGG CGGTGTCGGT CGACGAGCTG CGGGAGCTCA TGAAGACGCG CGAGCTCGCG CACCCGGTCA
CCATCGTCGT CGACTCGCCG TCGCCGGCCG CCGCAGCCGT CATCCGGGAG GTCGGCTCGT CGGGGGACAG CCGGAATGGG
CGGCGCCAGA GCGCGAGATC AGACGGCGCG CACTGGCCAC GGGTGAGCAT ATACAGGGGC CATCCATTCG TCAGAAACCG
TAGCTCAGAA GCCGGCAAGC TGATCAACCT GCCCGGCACC ATGGAAGAAT TCAGAATCAT CATAGGTAAA ATTCAGAAAC
CATGTAGAAG TAGCTATCTG AATCTTGCTG CAATTGCAAG ATCGTGCAGT TCAAACTAAC CGATGATTTC TGCTCCTTTT
TCTTTTCAGA GGAGAAACTG AAAGTCGACG CGAGGAAGAC GCTGATCATG AACGACGAAG GAGCGGAGAT TGACTCGATC
GACGTGATCC GGGACAACGA TAAGCTGTTC ATAGTGACCG AGGAGCATAT GACAGCAGTA GCATCGATGG ACTCGGTGTC
TGGATCATAG CATATTCGAG TTTGCTGAAT AAGGCCTTGT CCAGCTtgga gggatttgag tgggaatgtt tttgcatcac
aataggtgta aaactagtct ccccaatctg ttccttttag gattaaccga acaaagccTA ATCAAGTTTT CTATTGGCGA
CAATCC

Locus: Os05g0428700

Loading...

Locus: Os05g0428700

Loading...