Os05t0432200-00

Locus

Os05g0432200

Description

Similar to Gibberellin-regulated protein 2 precursor.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

CT833251 (DDBJ, Best hit)

Protein Evidence

NP_001152401.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

Gibberellin regulated protein (IPR003854)

Expression Databases

TENOR (Os05t0432200-00)

Others

KEGG (Os05t0432200-00)

Transcript

665 bp

>Os05t0432200-00 Similar to Gibberellin-regulated protein 2 precursor.
ATCACCTCCACCTCGCAAACAGAACCAGTACTTTAATTTCACCTTGCAAATTCAGTTGAA
TTCGGCTCGTTCAGGTTCAGTCGTTTGATCATCATGGCCAGTATGGCCAAGTCGCTCTTG
TGCATCTCGCTCGTCGCCATCCTGCTCCTCGTCGAGACTACTGCTCCACATGGACAAGCT
TACGCCATCGATTGCGGGGCGAAGTGCGGGTACCGGTGCAGCAAGTCGGGGCGGCCGAAG
ATGTGCCTGAGAGCATGCGGCACCTGCTGCCAGCGCTGCGGCTGCGTGCCGCCGGGCACC
TCCGGCAACGAGAACGTCTGCCCCTGCTACGCCAACATGACCACCCACAACGGCCGCCAC
AAGTGCCCTTGATCATCTCGACCAATATATCACCGCTCGATCACCGCGCCGCCGCTTTGC
TATCCAACCGACCGGTGATGATACATGGCGGCAACCTTGTGATGATCCTAGCTAGCTAGA
TGTGCTACCTACTTCGTGCCTGCATGCATGTAGCTTGCATATGCATGCTAGCTTTGCTAT
ATCGCGTATTTGCTACTTGGAATATGTATGATGTGTGTGCATATATATGTGGCGTGTCGT
GATCGATCGATCGATCGACCGTGTACGAGCAAATAAGTAATATAATGAAGTATTTGCTTT
TATGA

CDS

279 bp

>Os05t0432200-00 Similar to Gibberellin-regulated protein 2 precursor.
ATGGCCAGTATGGCCAAGTCGCTCTTGTGCATCTCGCTCGTCGCCATCCTGCTCCTCGTC
GAGACTACTGCTCCACATGGACAAGCTTACGCCATCGATTGCGGGGCGAAGTGCGGGTAC
CGGTGCAGCAAGTCGGGGCGGCCGAAGATGTGCCTGAGAGCATGCGGCACCTGCTGCCAG
CGCTGCGGCTGCGTGCCGCCGGGCACCTCCGGCAACGAGAACGTCTGCCCCTGCTACGCC
AACATGACCACCCACAACGGCCGCCACAAGTGCCCTTGA

Protein

92 aa

>Os05t0432200-00 Similar to Gibberellin-regulated protein 2 precursor.
MASMAKSLLCISLVAILLLVETTAPHGQAYAIDCGAKCGYRCSKSGRPKMCLRACGTCCQ
RCGCVPPGTSGNENVCPCYANMTTHNGRHKCP*

5'UTR

chr05:21198105..21198197 (+ strand) : 93 bp

CDS

chr05:21198198..21198260 (+ strand) : 63 bp

chr05:21198373..21198406 (+ strand) : 34 bp

chr05:21198513..21198694 (+ strand) : 182 bp

3'UTR

chr05:21198695..21198987 (+ strand) : 293 bp

FASTA

>Os05t0432200-00 class=Sequence position=chr05:21198105..21198987 (+ strand)
ATCACCTCCA CCTCGCAAAC AGAACCAGTA CTTTAATTTC ACCTTGCAAA TTCAGTTGAA TTCGGCTCGT TCAGGTTCAG
TCGTTTGATC ATCATGGCCA GTATGGCCAA GTCGCTCTTG TGCATCTCGC TCGTCGCCAT CCTGCTCCTC GTCGAGGTAA
TTAATCAGAT ATTTCAAACT GATCTTTTAA CCTAAACGAA ACGGTTTCCT GAATTGTATA TATTTCAGTT ACTGATCCGA
TCCTGTTTAT TTCTTGTTTG GTCTTCAGAC TACTGCTCCA CATGGACAAG CTTACGCCAT CGGTAAGCAA TGCGTGATCT
AGTTCAGTTT TTCTTTTCCC TTTTTTTCTG ATCTGTGTGA GTGTGATGAA CTGATGAGTT GCATGCAAAT GTATGTAATC
TCGTGTAGAT TGCGGGGCGA AGTGCGGGTA CCGGTGCAGC AAGTCGGGGC GGCCGAAGAT GTGCCTGAGA GCATGCGGCA
CCTGCTGCCA GCGCTGCGGC TGCGTGCCGC CGGGCACCTC CGGCAACGAG AACGTCTGCC CCTGCTACGC CAACATGACC
ACCCACAACG GCCGCCACAA GTGCCCTTGA TCATCTCGAC CAATATATCA CCGCTCGATC ACCGCGCCGC CGCTTTGCTA
TCCAACCGAC CGGTGATGAT ACATGGCGGC AACCTTGTGA TGATCCTAGC TAGCTAGATG TGCTACCTAC TTCGTGCCTG
CATGCATGTA GCTTGCATAT GCATGCTAGC TTTGCTATAT CGCGTATTTG CTACTTGGAA TATGTATGAT GTGTGTGCAT
ATATATGTGG CGTGTCGTGA TCGATCGATC GATCGACCGT GTACGAGCAA ATAAGTAATA TAATGAAGTA TTTGCTTTTA
TGA

Locus: Os05g0432200

Loading...

Locus: Os05g0432200

Loading...