Os05t0440800-01

Locus

Os05g0440800

Description

Serine/threonine protein kinase domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsNek4

Oryzabase Gene Name Synonym(s)

NIMA-related kinase 4

Transcript Evidence

AK073901 (DDBJ, Best hit)

Protein Evidence

Q60DG4 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J033071K16 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0440800-01)

RiceXPro (AK073901)

Others

Oryzabase (9928)

KEGG (Os05t0440800-01 (EC:2.7.11.1))

Transcript

3182 bp

>Os05t0440800-01 Serine/threonine protein kinase domain containing protein.
TTTCGATGCCTTTGCAGAAATCGCCTTGGTGCAGTGGAGTGGAGGTGTATGAGGTCGCGC
TCGGCCAGTAGGAATGAGATTGGTCTGGGTATCTAGGGTGGACTTGCTGCTGTGAAGCTG
TGATTGTTCTGTTAGGGATTTGGGGCACATGGAGTCGCGGATGGATCAGTACGAGATCAT
GGAGCAGGTTGGCCGGGGCGCCTTTGGTGCTGCAATCCTTGTGAATCATAAGATTGAGAG
GAAGAAGTATGTGTTGAAGAAAATCCGGCTTGCGAGGCAGACAGAGCGTTGCCGCAAGTC
TGCTCACCAAGAGATGGCTCTGATTGCTCGGTTGCAACACCCTTACATTGTTGAATTCAA
AGAGGCTTGGGTTGAGAAGGGTTGCTATGTCTGCATTGTCACGGGCTATTGTGAAGGTGG
AGATATGGATGAATTGATGAAGAAATTAAATGGTACTTACTTCCCAGAGGAGAAATTGCT
GAAATGGTTTGCTCAACTGGTATTAGCCGTGGACTATTTGCATTCGAACTATGTCTTGCA
TCGGGACCTGAAGTGCTCCAACATATTTCTCACCAAAGATCAAGATATACGCCTAGGAGA
CTTTGGGCTTGCTAAGACCTTAAAGGAAGATGATTTAACTTCTTCGGTTGTTGGAACACC
GAATTACATGTGTCCAGAGCTTCTCACAGATATCCCTTATGGATTCAAGTCAGACATCTG
GTCTCTTGGGTGCTGTATGTATGAGATGGCAGCTCATCGGCCTGCCTTCAAGGCTTTTGA
TATGGCTGGATTAATAAGTAAGATAAATAGGTCCTCCATTGGCCCCTTGCCTGCCTGTTA
CTCTTCTTCTATGAAAACTCTTATCAAAAGCATGTTGAGAAAAAGTCCTGAGCATCGACC
TACTGCATCTGAGATTCTGAAGAATCCGTATCTCCAACCTTATGTTAATCAATGCCGCCC
TCTTTCTGATGCTCCAACTCCCATACGCATGCCAGAGAAACCATTATCCACTTCACGGAG
TAATCAGAGATGCACGTCTGAGAGCCAAAGCAGTAGCATTTCTTGTAGTGATATCGACAG
TACACAATCAAGTGACAGAAGCACATCAGGGGGCGCTCCTAGCACTGACAGCAAGCTTAA
CGATATCAGAAGCATCCAAGATGCAGACCGAGCTGATTCAGACGAAAAATGTGTAACACC
AGAAGATCTTAGAGGCAACAAGAACATTTCTGGTGCTGAACTGAAAAGACAAGATTCCTC
AAAAAGTGTACATCAGCATCACAGGGGTGAGAGTAAGCAGCCAAAAATAATTGAGAAGAT
AATGACAACTCTTAGAGAGGAGAGTAGGCTTAGAGAAAACAATTCTCCTGTAAGTTCTAG
TGGTGTAAAGTTGACTTCTGCAGTTAGCAATAAGAATCAAGCAGAGCAATCATCAGAGAG
CTCAAGGCCTCACAGTGGTGTTTCATACAGTTCAAAGTTTGGTGACATTTCATCTAATGG
ATGGACCAATACAAGCGATGAATGTGTAGATCCAGTCCAGGTGCCATTGCAATTGAAACA
ACTGTCACCAACTGTTGAGCATTGTCCAAAGTTAAAAAATTCCGGGTCCTCAACTCCTGA
ACCTGCCAAACAGATTGCAGAAAATGGTTCCTCAGCTTCAGGAATGAGTAAAACCAAGTC
GTCACCTAGTTCTAGTAGACGGCCTAGTCCTCAGAGACAAACAGTAGCAGGAATTCCAAT
CGTGCCATTCACTGTGTCAAAACGAGCTCATATCAAGGCAGAGAGTGAGAAAACACCGCC
GCGACCTGCCCATAGCCCAAATAATTCTCTACATAATCTCCCTCCTTTGATACCGATATC
TACAAATCTGTCAGAAGAGAACATCAAGCTGGGTAATTCTCAGGCAATGCCAGCTCCTCT
GGAATTCGTGACTGCAGCATCCAAGGAGGACATCAGCTTTTACTCAAATTCTGTAGTTGA
TTGTGTTGAAAAGGCCGAGCCATCTGAAGTATTTGAATCTAATTCTCCAGCCTACCTGAC
TCCACCGTGGACAGGCCCAGTGCTTGATGCCAAAGGAGAGAATGGCCTAATAGCCATACC
ATGTTCAGAAATACACACTGGCACATTGCAGAAGAGTATGGCTAGTAATGATGATTCAAG
CCTGAGCTCTCCGTTGGATACATTTTATCTTAGTTTTGAACAAGAGTTTGTCTGCAAGGA
TGATTCGCAATCCAGCAAGCATGGGCACAGTGCTGTCACACTACTAAGTGGTGAGGACAA
ATTTACTGTCCAAGAACTTCTTGCATCAACACCAGTTATTTCTCCTTTTGTTTCAAGCAC
AAGTAACACTCTGCCAGAGGATAAAAGTTCTTACCAGTCATTCAAGAAACAATCAGATTC
ACATTCGGGCCCTCCAGTTGATGTTCCTGCACAGACTATTAGACTCAACAGTTTCCTTGT
TAGTGATGAGTGGCCAACATCAGAAACAGTTCAAGGGGAAGCTCGGGACACGGCTGCCAG
CAAGCTTCTGAATGTAGTAAGAGAAGATTTTGATGTAAGAAGCAGTTCATGCTCAACAAG
CACGCAACCTTCTGGACAAACCCCAGTTAGATCCAAACTCAACGTGCCTGAAACTAATCT
TGCCAGTAACATATCCATACCATCCATATCAGAAGCAGTGAGATTATCTACCGCCATGGA
CGTTAAACCGTACACGTCCGAGGCCAGCAATGGAGTCAAGGAGGAGGCATCTCCTGCCAA
GGAAGCTCTTGATGTTACGTCATTTAGGCAGCGAGCTGAGGCTCTAGAAGGTCTCTTGGA
GCTTTCTGCGGACTTGCTGGAAAACAACAGGTTGGAGGAACTCGCCATTGTTCTACAGCC
TTTCGGGAAGAACAAGGTCTCCCCGCGAGAGACCGCAATTTGGTTGGCCAGAAGTTTCAA
AGGAATGATGAACGAAGAAGGTGGCCGCCTGTCGATGTGAGTATCTGTAACCTTAAAAGG
CCTTTTTATTGCTTTCCCCTTTGCTTTTTTGAGTAGCTCAAAGTGGGCTTGATTTGCTGA
CAGCGTGTTGTGTTTGTGTTGCCCGGTTTTGTTTTTTGTTTCTTTTGATTCAAACCATTC
TTTTTGGCGCATGTTGTAAATAGCCAAGACTTGTAAACACTAATAAAATTTGCCTTCAGT
TC

CDS

2832 bp

>Os05t0440800-01 Serine/threonine protein kinase domain containing protein.
ATGGAGTCGCGGATGGATCAGTACGAGATCATGGAGCAGGTTGGCCGGGGCGCCTTTGGT
GCTGCAATCCTTGTGAATCATAAGATTGAGAGGAAGAAGTATGTGTTGAAGAAAATCCGG
CTTGCGAGGCAGACAGAGCGTTGCCGCAAGTCTGCTCACCAAGAGATGGCTCTGATTGCT
CGGTTGCAACACCCTTACATTGTTGAATTCAAAGAGGCTTGGGTTGAGAAGGGTTGCTAT
GTCTGCATTGTCACGGGCTATTGTGAAGGTGGAGATATGGATGAATTGATGAAGAAATTA
AATGGTACTTACTTCCCAGAGGAGAAATTGCTGAAATGGTTTGCTCAACTGGTATTAGCC
GTGGACTATTTGCATTCGAACTATGTCTTGCATCGGGACCTGAAGTGCTCCAACATATTT
CTCACCAAAGATCAAGATATACGCCTAGGAGACTTTGGGCTTGCTAAGACCTTAAAGGAA
GATGATTTAACTTCTTCGGTTGTTGGAACACCGAATTACATGTGTCCAGAGCTTCTCACA
GATATCCCTTATGGATTCAAGTCAGACATCTGGTCTCTTGGGTGCTGTATGTATGAGATG
GCAGCTCATCGGCCTGCCTTCAAGGCTTTTGATATGGCTGGATTAATAAGTAAGATAAAT
AGGTCCTCCATTGGCCCCTTGCCTGCCTGTTACTCTTCTTCTATGAAAACTCTTATCAAA
AGCATGTTGAGAAAAAGTCCTGAGCATCGACCTACTGCATCTGAGATTCTGAAGAATCCG
TATCTCCAACCTTATGTTAATCAATGCCGCCCTCTTTCTGATGCTCCAACTCCCATACGC
ATGCCAGAGAAACCATTATCCACTTCACGGAGTAATCAGAGATGCACGTCTGAGAGCCAA
AGCAGTAGCATTTCTTGTAGTGATATCGACAGTACACAATCAAGTGACAGAAGCACATCA
GGGGGCGCTCCTAGCACTGACAGCAAGCTTAACGATATCAGAAGCATCCAAGATGCAGAC
CGAGCTGATTCAGACGAAAAATGTGTAACACCAGAAGATCTTAGAGGCAACAAGAACATT
TCTGGTGCTGAACTGAAAAGACAAGATTCCTCAAAAAGTGTACATCAGCATCACAGGGGT
GAGAGTAAGCAGCCAAAAATAATTGAGAAGATAATGACAACTCTTAGAGAGGAGAGTAGG
CTTAGAGAAAACAATTCTCCTGTAAGTTCTAGTGGTGTAAAGTTGACTTCTGCAGTTAGC
AATAAGAATCAAGCAGAGCAATCATCAGAGAGCTCAAGGCCTCACAGTGGTGTTTCATAC
AGTTCAAAGTTTGGTGACATTTCATCTAATGGATGGACCAATACAAGCGATGAATGTGTA
GATCCAGTCCAGGTGCCATTGCAATTGAAACAACTGTCACCAACTGTTGAGCATTGTCCA
AAGTTAAAAAATTCCGGGTCCTCAACTCCTGAACCTGCCAAACAGATTGCAGAAAATGGT
TCCTCAGCTTCAGGAATGAGTAAAACCAAGTCGTCACCTAGTTCTAGTAGACGGCCTAGT
CCTCAGAGACAAACAGTAGCAGGAATTCCAATCGTGCCATTCACTGTGTCAAAACGAGCT
CATATCAAGGCAGAGAGTGAGAAAACACCGCCGCGACCTGCCCATAGCCCAAATAATTCT
CTACATAATCTCCCTCCTTTGATACCGATATCTACAAATCTGTCAGAAGAGAACATCAAG
CTGGGTAATTCTCAGGCAATGCCAGCTCCTCTGGAATTCGTGACTGCAGCATCCAAGGAG
GACATCAGCTTTTACTCAAATTCTGTAGTTGATTGTGTTGAAAAGGCCGAGCCATCTGAA
GTATTTGAATCTAATTCTCCAGCCTACCTGACTCCACCGTGGACAGGCCCAGTGCTTGAT
GCCAAAGGAGAGAATGGCCTAATAGCCATACCATGTTCAGAAATACACACTGGCACATTG
CAGAAGAGTATGGCTAGTAATGATGATTCAAGCCTGAGCTCTCCGTTGGATACATTTTAT
CTTAGTTTTGAACAAGAGTTTGTCTGCAAGGATGATTCGCAATCCAGCAAGCATGGGCAC
AGTGCTGTCACACTACTAAGTGGTGAGGACAAATTTACTGTCCAAGAACTTCTTGCATCA
ACACCAGTTATTTCTCCTTTTGTTTCAAGCACAAGTAACACTCTGCCAGAGGATAAAAGT
TCTTACCAGTCATTCAAGAAACAATCAGATTCACATTCGGGCCCTCCAGTTGATGTTCCT
GCACAGACTATTAGACTCAACAGTTTCCTTGTTAGTGATGAGTGGCCAACATCAGAAACA
GTTCAAGGGGAAGCTCGGGACACGGCTGCCAGCAAGCTTCTGAATGTAGTAAGAGAAGAT
TTTGATGTAAGAAGCAGTTCATGCTCAACAAGCACGCAACCTTCTGGACAAACCCCAGTT
AGATCCAAACTCAACGTGCCTGAAACTAATCTTGCCAGTAACATATCCATACCATCCATA
TCAGAAGCAGTGAGATTATCTACCGCCATGGACGTTAAACCGTACACGTCCGAGGCCAGC
AATGGAGTCAAGGAGGAGGCATCTCCTGCCAAGGAAGCTCTTGATGTTACGTCATTTAGG
CAGCGAGCTGAGGCTCTAGAAGGTCTCTTGGAGCTTTCTGCGGACTTGCTGGAAAACAAC
AGGTTGGAGGAACTCGCCATTGTTCTACAGCCTTTCGGGAAGAACAAGGTCTCCCCGCGA
GAGACCGCAATTTGGTTGGCCAGAAGTTTCAAAGGAATGATGAACGAAGAAGGTGGCCGC
CTGTCGATGTGA

Protein

944 aa

>Os05t0440800-01 Serine/threonine protein kinase domain containing protein.
MESRMDQYEIMEQVGRGAFGAAILVNHKIERKKYVLKKIRLARQTERCRKSAHQEMALIA
RLQHPYIVEFKEAWVEKGCYVCIVTGYCEGGDMDELMKKLNGTYFPEEKLLKWFAQLVLA
VDYLHSNYVLHRDLKCSNIFLTKDQDIRLGDFGLAKTLKEDDLTSSVVGTPNYMCPELLT
DIPYGFKSDIWSLGCCMYEMAAHRPAFKAFDMAGLISKINRSSIGPLPACYSSSMKTLIK
SMLRKSPEHRPTASEILKNPYLQPYVNQCRPLSDAPTPIRMPEKPLSTSRSNQRCTSESQ
SSSISCSDIDSTQSSDRSTSGGAPSTDSKLNDIRSIQDADRADSDEKCVTPEDLRGNKNI
SGAELKRQDSSKSVHQHHRGESKQPKIIEKIMTTLREESRLRENNSPVSSSGVKLTSAVS
NKNQAEQSSESSRPHSGVSYSSKFGDISSNGWTNTSDECVDPVQVPLQLKQLSPTVEHCP
KLKNSGSSTPEPAKQIAENGSSASGMSKTKSSPSSSRRPSPQRQTVAGIPIVPFTVSKRA
HIKAESEKTPPRPAHSPNNSLHNLPPLIPISTNLSEENIKLGNSQAMPAPLEFVTAASKE
DISFYSNSVVDCVEKAEPSEVFESNSPAYLTPPWTGPVLDAKGENGLIAIPCSEIHTGTL
QKSMASNDDSSLSSPLDTFYLSFEQEFVCKDDSQSSKHGHSAVTLLSGEDKFTVQELLAS
TPVISPFVSSTSNTLPEDKSSYQSFKKQSDSHSGPPVDVPAQTIRLNSFLVSDEWPTSET
VQGEARDTAASKLLNVVREDFDVRSSSCSTSTQPSGQTPVRSKLNVPETNLASNISIPSI
SEAVRLSTAMDVKPYTSEASNGVKEEASPAKEALDVTSFRQRAEALEGLLELSADLLENN
RLEELAIVLQPFGKNKVSPRETAIWLARSFKGMMNEEGGRLSM*

5'UTR

chr05:21587817..21587964 (+ strand) : 148 bp

CDS

chr05:21587965..21588062 (+ strand) : 98 bp

chr05:21588199..21588265 (+ strand) : 67 bp

chr05:21588372..21588437 (+ strand) : 66 bp

chr05:21588514..21588560 (+ strand) : 47 bp

chr05:21588644..21588689 (+ strand) : 46 bp

chr05:21588773..21588853 (+ strand) : 81 bp

chr05:21588927..21588969 (+ strand) : 43 bp

chr05:21589058..21589107 (+ strand) : 50 bp

chr05:21589408..21589489 (+ strand) : 82 bp

chr05:21589573..21589622 (+ strand) : 50 bp

chr05:21590631..21590704 (+ strand) : 74 bp

chr05:21590928..21590979 (+ strand) : 52 bp

chr05:21591057..21591716 (+ strand) : 660 bp

chr05:21591798..21593213 (+ strand) : 1416 bp

3'UTR

chr05:21593214..21593415 (+ strand) : 202 bp

FASTA

>Os05t0440800-01 class=Sequence position=chr05:21587817..21593415 (+ strand)
TTTCGATGCC TTTGCAGAAA TCGCCTTGGT GCAGTGGAGT GGAGGTGTAT GAGGTCGCGC TCGGCCAGTA GGAATGAGAT
TGGTCTGGGT ATCTAGGGTG GACTTGCTGC TGTGAAGCTG TGATTGTTCT GTTAGGGATT TGGGGCACAT GGAGTCGCGG
ATGGATCAGT ACGAGATCAT GGAGCAGGTT GGCCGGGGCG CCTTTGGTGC TGCAATCCTT GTGAATCATA AGATTGAGAG
GAAGAAGTGA GTGGCATAGT TCTATTTTAT TTTCATCTTT TTAACAACTT GATAACACTT ATGTTTCCTT TCACTAAGAT
GAAGAGTTTG ATTTTGCTGT TAATATTAGT CACCATATAT TTATATATGT TGTGTTGCAC AGGTATGTGT TGAAGAAAAT
CCGGCTTGCG AGGCAGACAG AGCGTTGCCG CAAGTCTGCT CACCAAGAGG TTAGTGGAAT GTGGAAGTGG AAGCTTGCAA
TCCCTAGGCT TTGTTTGTTC GGTTGTTTGC TAGTGGTATT ATTAGGAATT TGATCACGAC GAAAACGAAT TGCAGATGGC
TCTGATTGCT CGGTTGCAAC ACCCTTACAT TGTTGAATTC AAAGAGGCTT GGGTTGAGAA GGTTTGTGGA TTAGGAACTT
ACTATATCTA GCTTATCTGG TTTATACTTA TTTAGTTGAC ATGGGTCAGT AATGCAGGGT TGCTATGTCT GCATTGTCAC
GGGCTATTGT GAAGGTGGAG ATATGTGAGT GAGATTATGT TTTAGATTAG TTTTTCAAAT GTCATTTTGT ATATTTTGTT
GTATCTCAGT TTTCTCTTTT ATCACAGGGA TGAATTGATG AAGAAATTAA ATGGTACTTA CTTCCCAGAG GAGGTATGGA
ATGACTTCTT TGTTTTTGTC AGAATGAAGG GAAAAAGGCA TCCAAATATG TGCTAATAAT ACTGCATGTT TCTCAGAAAT
TGCTGAAATG GTTTGCTCAA CTGGTATTAG CCGTGGACTA TTTGCATTCG AACTATGTCT TGCATCGGGA CCTGAAGGTA
ACTTCAGAAC AGATAATATC ATTTTCTCTT ATTTAATTGG TAGATTTCAA TATTCTTGTC ATAATTGCAG TGCTCCAACA
TATTTCTCAC CAAAGATCAA GATATACGCC TAGGTTAGTT CCTTAATAAT AAACTACTAC AGGTCTGGAT GGTTCCATAT
TGGTTTATCA ACTTACACAT ATTCCTTGCC TTTGCATGCA GGAGACTTTG GGCTTGCTAA GACCTTAAAG GAAGATGATT
TAACTTCTTC GGTATGTTCC TTTTCCTATT TCTATGGTTG GTCTCTGGTA AAAAAAAAAT TGCATCACCT TAATTTTCCC
CACAATGATA AGAGCATTAC ATTTATTAAG TTTTGTAAGT TTTTAATCAT TGACACTGTC AGACACACCG ATGCAGTACA
TCATCAAAGA CACTAACCAT GCTGTTCATC ATGTGCATAT TATTCATTGT TTATAGTTAT CTCTTTTACA CACATTTATC
TGAATTTGTA AAATAGGTGA AGTTATTATT ATTTTTCTAT GCTCAAACTG ACAGCATAAT GCTTTCTTTA GGTTGTTGGA
ACACCGAATT ACATGTGTCC AGAGCTTCTC ACAGATATCC CTTATGGATT CAAGTCAGAC ATCTGGTCTC TTGGTAACTG
CCTTTTTCTC CTCAGGTCTT CTACAAGTTC ATATTACTGC ATATTTATCT TAATTTAAGT TACGCTTTCT ATATAGGGTG
CTGTATGTAT GAGATGGCAG CTCATCGGCC TGCCTTCAAG GCTTTTGTAA GCTACTGGGC TCTTATCATA TATTCTTGCT
TTATTATATT GTAATATACA GGTTTAGCTT TCATAGGGTC ATATGAGTTA CAGTTTTATC TTTTCGTGTC ACATGTTTTC
AAAAAGGTTC TTGCCTTAta ctccctccgt ttcaaaatgt ttgacaccgt tgacttttta atacgtgttt gaccattcgt
cttattcaaa aaatttaagt aattatttat tcttttcata tcatttgatt cattgttaaa tataatttca tgtacacata
tagttttaca tatttcacaa atttttttga ataagacgaa cggtcaaaca tgtgctaaaa agtcaacggt gtcaaatatt
ttgaaacgga gggagtaTAT TTTTATCTTG ACTTTAATAT TTGATAAACT GGAATATTAT GGTGGAAGTA GTATAAATCA
TTCCTAACTA ACTGTCCGGT TTCACATCTT TATTTAATTT GAAAATGTTT GTTACAGAAA TTATATTACA AACAACAATG
AAATTTTTTA ACTTAAATTA AATTTATTAG TATGTAAAAG TATGATGTTT GAAGATGGTG CTGAAAGGAA CTTTGGGTCA
GGTTACAGAA GCAAACAACC TACGGAGTAT AGACCTGCCA TTGCCCACCG GTAATTGGTC AGGTTGAATC GACTAAAAAT
TCAATAAATC TATTGGGTGT AATGATGTAA AATTGCAACC ATTACTTGTA CACGTGCACC TTGATCTTTC AATATGGTCT
TCCGTAAAAA CATGCTACTG AGGCATTTAC ATGTAGACTC TAACGCAATA ATTTGGAATA TATTGTGTTG TCCACAATAA
TCATAGAAAA GAAAAGAACA AATAAAACTA TATAAGTCAA TACATCTATT TGAAGTTTGA ACTTTGCCAA TAGAAAATAT
GGAACATTGG AATTCTTGTG TGCTATTTAA CAATGCTACT ATTTGTATTT GCCTTTTAAG TTTCAGTGAT CTTATGAATC
AACAATACCT GCAGGATATG GCTGGATTAA TAAGTAAGAT AAATAGGTCC TCCATTGGCC CCTTGCCTGC CTGTTACTCT
TCTTCTATGT AAGTGCATTT ATTGCATCGA AGCCACATTT TATTTTTATT TTTCATGCCT AAAAGTGATG TTGTAAGTAA
TTTCAATGAC AATAGAAGCA AGTCATCGTC TTATTTTTTA CAACCAAGTA ATGTTTTGGC AGGAGATACA TAATAGATGA
AATTGGCTAA AACCTTAACA CATTTCCATT TTAATGCAAG TATACATGCT TCTAATTGCT GTTGTGTACA GGAAAACTCT
TATCAAAAGC ATGTTGAGAA AAAGTCCTGA GCATCGACCT ACTGTAAGTT ACCACAGTTC TTGAAATAGC TTTATTTCTT
CATCTGGATT CTGAAAACAC ATGAAAAATC TTGTTAACAG GCATCTGAGA TTCTGAAGAA TCCGTATCTC CAACCTTATG
TTAATCAATG CCGCCCTCTT TCTGATGCTC CAACTCCCAT ACGCATGCCA GAGAAACCAT TATCCACTTC ACGGAGTAAT
CAGAGATGCA CGTCTGAGAG CCAAAGCAGT AGCATTTCTT GTAGTGATAT CGACAGTACA CAATCAAGTG ACAGAAGCAC
ATCAGGGGGC GCTCCTAGCA CTGACAGCAA GCTTAACGAT ATCAGAAGCA TCCAAGATGC AGACCGAGCT GATTCAGACG
AAAAATGTGT AACACCAGAA GATCTTAGAG GCAACAAGAA CATTTCTGGT GCTGAACTGA AAAGACAAGA TTCCTCAAAA
AGTGTACATC AGCATCACAG GGGTGAGAGT AAGCAGCCAA AAATAATTGA GAAGATAATG ACAACTCTTA GAGAGGAGAG
TAGGCTTAGA GAAAACAATT CTCCTGTAAG TTCTAGTGGT GTAAAGTTGA CTTCTGCAGT TAGCAATAAG AATCAAGCAG
AGCAATCATC AGAGAGCTCA AGGCCTCACA GTGGTGTTTC ATACAGTTCA AAGTTTGGTG ACATTTCATC TAATGGATGG
ACCAATACAA GCGATGAATG TGTAGATCCA GTCCAGGTGC CATTGCAATT GAAACAACTG GTATGAGCCT ATATTTCTTA
TCACAAAACG TCCATTTATT TTTCTTCTTC TAATAGGTTT TGCTTGGTTC TGGTTTTGCA GTCACCAACT GTTGAGCATT
GTCCAAAGTT AAAAAATTCC GGGTCCTCAA CTCCTGAACC TGCCAAACAG ATTGCAGAAA ATGGTTCCTC AGCTTCAGGA
ATGAGTAAAA CCAAGTCGTC ACCTAGTTCT AGTAGACGGC CTAGTCCTCA GAGACAAACA GTAGCAGGAA TTCCAATCGT
GCCATTCACT GTGTCAAAAC GAGCTCATAT CAAGGCAGAG AGTGAGAAAA CACCGCCGCG ACCTGCCCAT AGCCCAAATA
ATTCTCTACA TAATCTCCCT CCTTTGATAC CGATATCTAC AAATCTGTCA GAAGAGAACA TCAAGCTGGG TAATTCTCAG
GCAATGCCAG CTCCTCTGGA ATTCGTGACT GCAGCATCCA AGGAGGACAT CAGCTTTTAC TCAAATTCTG TAGTTGATTG
TGTTGAAAAG GCCGAGCCAT CTGAAGTATT TGAATCTAAT TCTCCAGCCT ACCTGACTCC ACCGTGGACA GGCCCAGTGC
TTGATGCCAA AGGAGAGAAT GGCCTAATAG CCATACCATG TTCAGAAATA CACACTGGCA CATTGCAGAA GAGTATGGCT
AGTAATGATG ATTCAAGCCT GAGCTCTCCG TTGGATACAT TTTATCTTAG TTTTGAACAA GAGTTTGTCT GCAAGGATGA
TTCGCAATCC AGCAAGCATG GGCACAGTGC TGTCACACTA CTAAGTGGTG AGGACAAATT TACTGTCCAA GAACTTCTTG
CATCAACACC AGTTATTTCT CCTTTTGTTT CAAGCACAAG TAACACTCTG CCAGAGGATA AAAGTTCTTA CCAGTCATTC
AAGAAACAAT CAGATTCACA TTCGGGCCCT CCAGTTGATG TTCCTGCACA GACTATTAGA CTCAACAGTT TCCTTGTTAG
TGATGAGTGG CCAACATCAG AAACAGTTCA AGGGGAAGCT CGGGACACGG CTGCCAGCAA GCTTCTGAAT GTAGTAAGAG
AAGATTTTGA TGTAAGAAGC AGTTCATGCT CAACAAGCAC GCAACCTTCT GGACAAACCC CAGTTAGATC CAAACTCAAC
GTGCCTGAAA CTAATCTTGC CAGTAACATA TCCATACCAT CCATATCAGA AGCAGTGAGA TTATCTACCG CCATGGACGT
TAAACCGTAC ACGTCCGAGG CCAGCAATGG AGTCAAGGAG GAGGCATCTC CTGCCAAGGA AGCTCTTGAT GTTACGTCAT
TTAGGCAGCG AGCTGAGGCT CTAGAAGGTC TCTTGGAGCT TTCTGCGGAC TTGCTGGAAA ACAACAGGTT GGAGGAACTC
GCCATTGTTC TACAGCCTTT CGGGAAGAAC AAGGTCTCCC CGCGAGAGAC CGCAATTTGG TTGGCCAGAA GTTTCAAAGG
AATGATGAAC GAAGAAGGTG GCCGCCTGTC GATGTGAGTA TCTGTAACCT TAAAAGGCCT TTTTATTGCT TTCCCCTTTG
CTTTTTTGAG TAGCTCAAAG TGGGCTTGAT TTGCTGACAG CGTGTTGTGT TTGTGTTGCC CGGTTTTGTT TTTTGTTTCT
TTTGATTCAA ACCATTCTTT TTGGCGCATG TTGTAAATAG CCAAGACTTG TAAACACTAA TAAAATTTGC CTTCAGTTC

Locus: Os05g0440800

Loading...

Locus: Os05g0440800

Loading...