Os05t0442700-01

Locus

Os05g0442700

Description

No apical meristem (NAM) protein domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

NAC12

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 12

Oryzabase Gene Symbol Synonym(s)

ONAC012, ONAC12

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 012, NAC domain-containing protein 12

Transcript Evidence

AK063703 (DDBJ, Best hit)

Protein Evidence

XP_002336754.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

No apical meristem (NAM) protein (IPR003441)

Full-length cDNA

001-119-G11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0442700-01)

RiceXPro (AK063703)

Others

Oryzabase (11462)

KEGG (Os05t0442700-01)

Transcript

1150 bp

>Os05t0442700-01 No apical meristem (NAM) protein domain containing protein.
ATACGAGCCTTTGCTACCCACCACGAGAGAGACGCCCACCGTACATCGATCCATCGCCGG
CCGGCCGCACACGGGGTGGATTGAGATCGATCGATCGATCGGGCAGCGGCGGACATGGGA
GAGCTGCctccggggtaccggttctaccccactgaggaggagctggtgtgcttctacctc
cggcacaagctcgacggcggccgacgcgtccccgacatcgagcgcgtcatccccgtcgcc
gacgtctgctccctcgatccATGGCAGCTCCCAGAGGCGCACCAGGGCGCGTGGACCGGC
GACGGCGAGCCGTGGTTCTACTTCTGCCCGCGGCAGGAGCGGGAGGCGCGGGGCGGGCGG
CCGAGCCGCACGACGCCGTCGGGGTACTGGAAGGCCGCGGGCACGCCGGGGTGGGTCTAC
TCCTCCGACGGCCGCCCCATCGGCACCAAGAAGACCATGGTGTTCTACCGCGGCCGCGCG
CCGGCGGGGGCCAAGACCAAGTGGAAGATGAACGAGTACAGGGCCTTCGAGGAAGACGAC
GACAACGCAGCCGCCGCTGCTCCGGCACAGAACCATTATCTCCAGACGAGGAGTGACTTC
AGCTTGTGCCGGCTGTACACCAGGTCAGGGTGCCCCCGGCAGTTCGATCGCCGGCCGCCG
AGCTCCTCGGTGGCAGGCGGCGGCGGCGAGAACCGGGCGGCGCCGTCATCCACCGCGGCT
GCGTTTGCCAACGAGGATGCTGCTGAATCCTCCGGGAAGAGTCAGAAGAGGAAAAGGAGC
GCGCCAGATGACAGCCTTGACAGCACCTCATCCAGCGACGACAATGGCGGCTGCGATGGC
TCTATGCTGCAGCAACAGCAGCAGAGGCAGAGAGGAACCGATGAGGAGCTTGTAGAGTGC
AGCATGACGGACTGGGCAGATCTTTTGGACTGGTTTTGATGTAGGAATTCGATTTTACGG
TCGGTCGTAAATTCAAGAAAACGGCGGTCGATCTCTAATTTTTGTTGCTAATTTTCATTA
TTTTTTTCGTGTTGCCAAAAAATATTTTAGCAGTCAAATGGTAAATTTTGAGAAAGATCT
CAGACAGTTGGCAGCTCAAAGACACAATTTTTTAATGATAACGGAAACTAATAAAAGCCT
GCTGAAAATC

CDS

825 bp

>Os05t0442700-01 No apical meristem (NAM) protein domain containing protein.
ATGGGAGAGCTGCctccggggtaccggttctaccccactgaggaggagctggtgtgcttc
tacctccggcacaagctcgacggcggccgacgcgtccccgacatcgagcgcgtcatcccc
gtcgccgacgtctgctccctcgatccATGGCAGCTCCCAGAGGCGCACCAGGGCGCGTGG
ACCGGCGACGGCGAGCCGTGGTTCTACTTCTGCCCGCGGCAGGAGCGGGAGGCGCGGGGC
GGGCGGCCGAGCCGCACGACGCCGTCGGGGTACTGGAAGGCCGCGGGCACGCCGGGGTGG
GTCTACTCCTCCGACGGCCGCCCCATCGGCACCAAGAAGACCATGGTGTTCTACCGCGGC
CGCGCGCCGGCGGGGGCCAAGACCAAGTGGAAGATGAACGAGTACAGGGCCTTCGAGGAA
GACGACGACAACGCAGCCGCCGCTGCTCCGGCACAGAACCATTATCTCCAGACGAGGAGT
GACTTCAGCTTGTGCCGGCTGTACACCAGGTCAGGGTGCCCCCGGCAGTTCGATCGCCGG
CCGCCGAGCTCCTCGGTGGCAGGCGGCGGCGGCGAGAACCGGGCGGCGCCGTCATCCACC
GCGGCTGCGTTTGCCAACGAGGATGCTGCTGAATCCTCCGGGAAGAGTCAGAAGAGGAAA
AGGAGCGCGCCAGATGACAGCCTTGACAGCACCTCATCCAGCGACGACAATGGCGGCTGC
GATGGCTCTATGCTGCAGCAACAGCAGCAGAGGCAGAGAGGAACCGATGAGGAGCTTGTA
GAGTGCAGCATGACGGACTGGGCAGATCTTTTGGACTGGTTTTGA

Protein

275 aa

>Os05t0442700-01 No apical meristem (NAM) protein domain containing protein.
MGELPPGYRFYPTEEELVCFYLRHKLDGGRRVPDIERVIPVADVCSLDPWQLPEAHQGAW
TGDGEPWFYFCPRQEREARGGRPSRTTPSGYWKAAGTPGWVYSSDGRPIGTKKTMVFYRG
RAPAGAKTKWKMNEYRAFEEDDDNAAAAAPAQNHYLQTRSDFSLCRLYTRSGCPRQFDRR
PPSSSVAGGGGENRAAPSSTAAAFANEDAAESSGKSQKRKRSAPDDSLDSTSSSDDNGGC
DGSMLQQQQQRQRGTDEELVECSMTDWADLLDWF*

5'UTR

chr05:21669615..21669728 (- strand) : 114 bp

CDS

chr05:21669455..21669614 (- strand) : 160 bp

chr05:21669022..21669332 (- strand) : 311 bp

chr05:21668404..21668757 (- strand) : 354 bp

3'UTR

chr05:21668193..21668403 (- strand) : 211 bp

FASTA

>Os05t0442700-01 class=Sequence position=chr05:21668193..21669728 (- strand)
ATACGAGCCT TTGCTACCCA CCACGAGAGA GACGCCCACC GTACATCGAT CCATCGCCGG CCGGCCGCAC ACGGGGTGGA
TTGAGATCGA TCGATCGATC GGGCAGCGGC GGACATGGGA GAGCTGCctc cggggtaccg gttctacccc actgaggagg
agctggtgtg cttctacctc cggcacaagc tcgacggcgg ccgacgcgtc cccgacatcg agcgcgtcat ccccgtcgcc
gacgtctgct ccctcgatcc ATGGCAGCTC CCAGGCACGT TGATCGTCGT CGTCGTCGTC CTTGCAGCTA ATTGTATTTA
CACCTTGCGT ATGCCGTGCA ATGCGTGTTC GCGCCGCCGC TAGCTAACGG GGGTCGTTCT TGATTACGTT GTGCAGAGGC
GCACCAGGGC GCGTGGACCG GCGACGGCGA GCCGTGGTTC TACTTCTGCC CGCGGCAGGA GCGGGAGGCG CGGGGCGGGC
GGCCGAGCCG CACGACGCCG TCGGGGTACT GGAAGGCCGC GGGCACGCCG GGGTGGGTCT ACTCCTCCGA CGGCCGCCCC
ATCGGCACCA AGAAGACCAT GGTGTTCTAC CGCGGCCGCG CGCCGGCGGG GGCCAAGACC AAGTGGAAGA TGAACGAGTA
CAGGGCCTTC GAGGAAGACG ACGACAACGC AGCCGCCGCT GCTCCGGCAC AGAACCATTA TCTCCAGGTA AATTGAACTT
AGAGATGCCT CTTTTTTTTT ATCCTATCCT ATTTTTTTTA GATATGGAAT TAAGTCCTAT ATAACAAACC TAACATCATG
GTCAAGTTGC AACTTCAATC ATTTCTCATT CCAAAACAAA ACATACTCCT TTATGCTCTA GTTGCAATGG TGATCGTGAT
GAGAGGCGGC TAGCTACTGT AGACGCACGA GCCGTGAGGG AAACTACAAC TTGGAATATA AAACGTTAAT TTGTGCTTGT
TAATTTCGCA GACGAGGAGT GACTTCAGCT TGTGCCGGCT GTACACCAGG TCAGGGTGCC CCCGGCAGTT CGATCGCCGG
CCGCCGAGCT CCTCGGTGGC AGGCGGCGGC GGCGAGAACC GGGCGGCGCC GTCATCCACC GCGGCTGCGT TTGCCAACGA
GGATGCTGCT GAATCCTCCG GGAAGAGTCA GAAGAGGAAA AGGAGCGCGC CAGATGACAG CCTTGACAGC ACCTCATCCA
GCGACGACAA TGGCGGCTGC GATGGCTCTA TGCTGCAGCA ACAGCAGCAG AGGCAGAGAG GAACCGATGA GGAGCTTGTA
GAGTGCAGCA TGACGGACTG GGCAGATCTT TTGGACTGGT TTTGATGTAG GAATTCGATT TTACGGTCGG TCGTAAATTC
AAGAAAACGG CGGTCGATCT CTAATTTTTG TTGCTAATTT TCATTATTTT TTTCGTGTTG CCAAAAAATA TTTTAGCAGT
CAAATGGTAA ATTTTGAGAA AGATCTCAGA CAGTTGGCAG CTCAAAGACA CAATTTTTTA ATGATAACGG AAACTAATAA
AAGCCTGCTG AAAATC

Locus: Os05g0442700

Loading...

Locus: Os05g0442700

Loading...