Os05t0443500-01

Locus

Os05g0443500

Description

Similar to Ferredoxin VI, chloroplast precursor (Fd VI).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Fd, OsFd4, Fd4

Oryzabase Gene Name Synonym(s)

ferredoxin, Ferredoxin B1, ferredoxin 4

Transcript Evidence

AK103416 (DDBJ, Best hit)

Protein Evidence

Q8S3J5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: electron transport chain (GO:0022900)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: iron-sulfur cluster binding (GO:0051536)

Molecular Function: 2 iron, 2 sulfur cluster binding (GO:0051537)

Functional domain (InterPro)

Ferredoxin (IPR001041)

2Fe-2S ferredoxin, iron-sulphur binding site (IPR006058)

Ferredoxin [2Fe-2S], plant (IPR010241)

Beta-grasp fold, ferredoxin-type (IPR012675)

Full-length cDNA

J033128I21 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0443500-01)

RiceXPro (AK103416)

Others

Oryzabase (14411)

KEGG (Os05t0443500-01)

Transcript

1336 bp

>Os05t0443500-01 Similar to Ferredoxin VI, chloroplast precursor (Fd VI).
cttcttcttacttaccctcccttctgatcccctgtttcccctggtcatggcggcgagatc
tccgtgtaggagtgagaTCGCCGCCTCCTCCTCATGGTGTTTCCTGGTGCGGCGCGCGTG
AGAGCTCGGCCCGAGCCCGAGCCCTCTCGCTTTTGCCGTGCCGGATCTGATTCTGTCCGT
GCTAGTGTTAGTGTCACGTTTTGGTGTAGACAGTAGACTCATGAAACGAGGAGAGGCTTT
TTTGTAGGATGGGTCAACTTTTAGGAACTTGTCCAAAGTTTAACAACTCTCAAGGATGAA
CTGGGAATAGTGGCGCTGTTATACATTAGGAGTTGGTCTGCGAGAAATTTGGATGGGATT
AGTTGCGGATCTTCCATCAGCTAGTGGAGCTTAAAGATACTGATGTGTTGTCCGTACTGA
AATGCACTTCTTTGCCTTGGCAAAACCCCAGTCTCCCCCATAAATTTAGTTTTGTTTGCT
TAGCTTTACCAAATGCCATCAGCATACATGGTGTAAAATCATATACTTTTGTAACGAACG
AATTGTGTTTATTTGCATTTCAACTAGTGCTTTCTTCCTAATTTATCAGGACTATCGAGA
TGGCAACTGCAACTGCTCCGAGATTGTGCTTTCCTAAACCCGGCGCGGCCATTGCTCCGG
CGACCAAGAGCCCTTCCTTCATTGGTTACGCAAAGCAAACATTGAACATGTCAGGCCTAA
GGATCTCCAACAAGTTCAGGGTGTCCGCGACAGCGGTGCACAAGGTAAAGCTTATAGGCC
CGGACGGTGTCGAGCACGAGTTTGAAGCCCCTGAAGATACCTACATTCTCGAGGCCGCTG
AAACTGCCGGGGTGGAGCTGCCATTCTCATGCCGTGCTGGATCATGCTCCACATGTGCGG
GTAAGATGTCATCGGGAGAAGTTGATCAGTCGGAAGGATCCTTCCTCGACGAGAACCAGA
TGGGCGAGGGATACGTTCTGACATGCATTTCGTACCCTAAGGCGGATTGCGTCATTCACA
CCCACAAGGAGGAAGAACTCTACTAGGTCGCTCTTTTTATGCTTCTGTGGGCACATTTGC
TGATTTCAAAGTGGACTCGCTGTTCAGTTAGTTTTCGCTATCCAAAAAATGGCCATATCT
TTGTATTAGTCTTTTGATGGGACCGTGTCATATGAGTTGTGACAATAATTGTCGTAGTCC
TGTTCAGCATTTCAAATTGCGTTTGTTCAATTCACAGCAGGTCCAACTTCCAACGATGAC
ATGTTATCAGAAGTTGTGTGTAATGGTATTATTGTGGATCACTTCCAGTAGGAAAAAATT
GACTTGTCCTTTCTCC

CDS

447 bp

>Os05t0443500-01 Similar to Ferredoxin VI, chloroplast precursor (Fd VI).
ATGGCAACTGCAACTGCTCCGAGATTGTGCTTTCCTAAACCCGGCGCGGCCATTGCTCCG
GCGACCAAGAGCCCTTCCTTCATTGGTTACGCAAAGCAAACATTGAACATGTCAGGCCTA
AGGATCTCCAACAAGTTCAGGGTGTCCGCGACAGCGGTGCACAAGGTAAAGCTTATAGGC
CCGGACGGTGTCGAGCACGAGTTTGAAGCCCCTGAAGATACCTACATTCTCGAGGCCGCT
GAAACTGCCGGGGTGGAGCTGCCATTCTCATGCCGTGCTGGATCATGCTCCACATGTGCG
GGTAAGATGTCATCGGGAGAAGTTGATCAGTCGGAAGGATCCTTCCTCGACGAGAACCAG
ATGGGCGAGGGATACGTTCTGACATGCATTTCGTACCCTAAGGCGGATTGCGTCATTCAC
ACCCACAAGGAGGAAGAACTCTACTAG

Protein

149 aa

>Os05t0443500-01 Similar to Ferredoxin VI, chloroplast precursor (Fd VI).
MATATAPRLCFPKPGAAIAPATKSPSFIGYAKQTLNMSGLRISNKFRVSATAVHKVKLIG
PDGVEHEFEAPEDTYILEAAETAGVELPFSCRAGSCSTCAGKMSSGEVDQSEGSFLDENQ
MGEGYVLTCISYPKADCVIHTHKEEELY*

5'UTR

chr05:21706488..21707086 (- strand) : 599 bp

CDS

chr05:21706041..21706487 (- strand) : 447 bp

3'UTR

chr05:21705751..21706040 (- strand) : 290 bp

FASTA

>Os05t0443500-01 class=Sequence position=chr05:21705751..21707086 (- strand)
cttcttctta cttaccctcc cttctgatcc cctgtttccc ctggtcatgg cggcgagatc tccgtgtagg agtgagaTCG
CCGCCTCCTC CTCATGGTGT TTCCTGGTGC GGCGCGCGTG AGAGCTCGGC CCGAGCCCGA GCCCTCTCGC TTTTGCCGTG
CCGGATCTGA TTCTGTCCGT GCTAGTGTTA GTGTCACGTT TTGGTGTAGA CAGTAGACTC ATGAAACGAG GAGAGGCTTT
TTTGTAGGAT GGGTCAACTT TTAGGAACTT GTCCAAAGTT TAACAACTCT CAAGGATGAA CTGGGAATAG TGGCGCTGTT
ATACATTAGG AGTTGGTCTG CGAGAAATTT GGATGGGATT AGTTGCGGAT CTTCCATCAG CTAGTGGAGC TTAAAGATAC
TGATGTGTTG TCCGTACTGA AATGCACTTC TTTGCCTTGG CAAAACCCCA GTCTCCCCCA TAAATTTAGT TTTGTTTGCT
TAGCTTTACC AAATGCCATC AGCATACATG GTGTAAAATC ATATACTTTT GTAACGAACG AATTGTGTTT ATTTGCATTT
CAACTAGTGC TTTCTTCCTA ATTTATCAGG ACTATCGAGA TGGCAACTGC AACTGCTCCG AGATTGTGCT TTCCTAAACC
CGGCGCGGCC ATTGCTCCGG CGACCAAGAG CCCTTCCTTC ATTGGTTACG CAAAGCAAAC ATTGAACATG TCAGGCCTAA
GGATCTCCAA CAAGTTCAGG GTGTCCGCGA CAGCGGTGCA CAAGGTAAAG CTTATAGGCC CGGACGGTGT CGAGCACGAG
TTTGAAGCCC CTGAAGATAC CTACATTCTC GAGGCCGCTG AAACTGCCGG GGTGGAGCTG CCATTCTCAT GCCGTGCTGG
ATCATGCTCC ACATGTGCGG GTAAGATGTC ATCGGGAGAA GTTGATCAGT CGGAAGGATC CTTCCTCGAC GAGAACCAGA
TGGGCGAGGG ATACGTTCTG ACATGCATTT CGTACCCTAA GGCGGATTGC GTCATTCACA CCCACAAGGA GGAAGAACTC
TACTAGGTCG CTCTTTTTAT GCTTCTGTGG GCACATTTGC TGATTTCAAA GTGGACTCGC TGTTCAGTTA GTTTTCGCTA
TCCAAAAAAT GGCCATATCT TTGTATTAGT CTTTTGATGG GACCGTGTCA TATGAGTTGT GACAATAATT GTCGTAGTCC
TGTTCAGCAT TTCAAATTGC GTTTGTTCAA TTCACAGCAG GTCCAACTTC CAACGATGAC ATGTTATCAG AAGTTGTGTG
TAATGGTATT ATTGTGGATC ACTTCCAGTA GGAAAAAATT GACTTGTCCT TTCTCC

Locus: Os05g0443500

Loading...

Locus: Os05g0443500

Loading...