Os05t0447200-01

Locus

Os05g0447200

Description

Auxin influx carrier, Regulation of root development, Response to aluminium stress

RAP-DB Gene Symbol Synonym(s)

OsAUX3

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX3, OsRAU3, OsAUX2, LAX3, RAU3, AUX2, OsAUX3, AUX3, ARF2

Oryzabase Gene Name Synonym(s)

like aux1-3, related to AUX1-3, auxin transporter 2

Transcript Evidence

AK111659

Protein Evidence

Q688J2

Literature

PMID: 30399648

Note

Manual Curation

November 14, 2019

Functional domain (InterPro)

Amino acid transporter, transmembrane domain (IPR013057)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

Full-length cDNA

J013151H06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0447200-01)

RiceXPro (AK111659)

Others

Oryzabase (11918)

KEGG (Os05t0447200-01)

Transcript

2260 bp

>Os05t0447200-01 Auxin influx carrier, Regulation of root development, Response to aluminium stress
TTCTCCCCTCCCACCGTCCCAACTCCCACGTCCGGCTCGGCTCGGGCCTCTCCGTGCCAG
AGAGTTTCACTCCTCGCGGAGAAGGAAAAACCGGAGGCGCGCGCGCAGTCGTGGCCGGGG
TTGGGAAGATCCGAGAGGCAAGGGGCAAGGGCGGCGTGCGGGTCTGCAGGATCAGGATCC
CGAAAAGCTAGCCCGCGGCGAAGTAATAATAACTGCTCCTCTGAATCTCTCCGATCCTCT
CGAACCACGAGAAGCTCAGCAGTTTCGGCTCCGCGCGCCGCCTGCCTCTCGGTCGACAGC
ACAGTAAATTCCGCCGGCGCGTGGTGCAGCTTTGCCGGCAGCGTGCCGCTCCCACGGCCA
TTTACTTCGCCTCCTCTCCTGAGGCAGGCGCGCGGCTGGAGACGGGAAGACCGGGGAGGA
CAGGAGGATGGTGCCGGCCGGCGACCAGGCGGAGGAGGCCATCGTGGCGGACGCCGGGAA
GGAGGAGGCGGAGGTGCGCGCGGCCATGGGCGTCGAGCAGGACGGCAAGTTCAGCATGAC
GAGCCTCCTGTGGCACGGCGGCTCCGTCTGGGACGCCTGGTTCAGCTGCGCCTCCAACCA
GGTACGACCAACCACGAACGACCTCGTCATGCCTCTCGCTCACATTTCGTTTGGAATTTT
GCAGGTGGCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCGCAGCTCGGGATGCTCTC
GGGCCTGCTGCTGCAGGTGTTCTACGGCCTCATGGGCAGCTGGACCGCCTACCTCATCAG
CGTCCTCTACGTCGAGTACCGCGCCCGCAAGGAGAAGGAAGGCGTCAGCTTCAAGAACCA
CGTCATCCAGTGGTTCGAAGTTCTTGATGGGCTCTTGGGCCCGTACTGGAAGGCGGCCGG
CCTCGCCTTCAACTGCACCTTCCTGCTCTTCGGCTCCGTCATCCAGCTGATCGCCTGTGC
AAGTAACATATACTACATCAACGACCGGCTGGACAAGAGGACATGGACGTACATATTCGG
GGCGTGCTGCTCCACCACGGTGTTCATCCCCTCCTTCCACAACTACCGCATCTGGTCCTT
CCTTGGCCTCGGCATGACCACCTACACCGCCTGGTACCTCGCCATCGCCGCCGCCGTCCA
CGGCCAGGTCGACGGCGTGACGCACTCGGGCCCGAGCAAGATGGTGCTCTACTTCACTGG
CGCCACCAACATCCTCTACACTTTCGGCGGACACGCCGTCACTGTAGAGATCATGCACGC
GATGTGGAAGCCGCAGAAGTTCAAGTACATCTACCTGGTGGCGACGCTGTACGTGTTCAC
GCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGCGACGCGCTGCTGACGCA
CTCGAACGCCTTCTCGCTGCTGCCGCGGTCCGGGTGGCGCGACGCGGCGGTGATCCTGAT
GCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACCCCGCTCTACTTCGTGTGGGA
GAAGGCGATCGGCATGCACGGCACCCGCAGCGTCCTCACCCGCGCGCTCGCCCGCCTCCC
CATCGTCGTGCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTC
CGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATCCCCTCCCTCTCCCACAT
CCTCACGTACCGCTCCGCCTCCGCCAGATTGAATGCGGCGGAGAAGCCGCCGCCGTTCCT
GCCGAGCTGGAGCGGGATGTTCGTGGTGAACGTGTTCGTGGTGGCGTGGGTGCTGGTGGT
CGGGTTCGGCCTCGGCGGCTGGGCCAGCGTCACCAACTTCATCAAGCAGATCGACACGTT
CGGGCTCTTCGCCAAGTGCTACCAGTGCCCACCCAGGGCGCACGCCGGGGCGCCCCTGCC
GGCTCCGCCGCGCCACTAGCCAAAAAAACCGAGTGCCACGCCGCGACGGCGCGACGCCGC
GCGCGGGCCGGTGACAAAAGGAGCTAGCTTCCCCGCGGGCGTCTTGCCTTTGTGTAGTAG
GACAGCAGGTCAGCAGCATACATGGTAGGACAGCGCGTGGGTCACTGACTAGATTTACCG
CCCTGCAGGGGCTTCCCTATGCTGCGGAGTCTTCAGTTCATGTGTGTTGTTGGCAACTTT
GCGTCGTCCTCTTTTGTTTGGGAGTTGGATGTGAACTTGGTCGTAATTTGTAGGTTCTTC
TGTTCATGTTACATGCCAATATAAAACGCCATATTTGTTC

CDS

1512 bp

>Os05t0447200-01 Auxin influx carrier, Regulation of root development, Response to aluminium stress
ATGGTGCCGGCCGGCGACCAGGCGGAGGAGGCCATCGTGGCGGACGCCGGGAAGGAGGAG
GCGGAGGTGCGCGCGGCCATGGGCGTCGAGCAGGACGGCAAGTTCAGCATGACGAGCCTC
CTGTGGCACGGCGGCTCCGTCTGGGACGCCTGGTTCAGCTGCGCCTCCAACCAGGTACGA
CCAACCACGAACGACCTCGTCATGCCTCTCGCTCACATTTCGTTTGGAATTTTGCAGGTG
GCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCGCAGCTCGGGATGCTCTCGGGCCTG
CTGCTGCAGGTGTTCTACGGCCTCATGGGCAGCTGGACCGCCTACCTCATCAGCGTCCTC
TACGTCGAGTACCGCGCCCGCAAGGAGAAGGAAGGCGTCAGCTTCAAGAACCACGTCATC
CAGTGGTTCGAAGTTCTTGATGGGCTCTTGGGCCCGTACTGGAAGGCGGCCGGCCTCGCC
TTCAACTGCACCTTCCTGCTCTTCGGCTCCGTCATCCAGCTGATCGCCTGTGCAAGTAAC
ATATACTACATCAACGACCGGCTGGACAAGAGGACATGGACGTACATATTCGGGGCGTGC
TGCTCCACCACGGTGTTCATCCCCTCCTTCCACAACTACCGCATCTGGTCCTTCCTTGGC
CTCGGCATGACCACCTACACCGCCTGGTACCTCGCCATCGCCGCCGCCGTCCACGGCCAG
GTCGACGGCGTGACGCACTCGGGCCCGAGCAAGATGGTGCTCTACTTCACTGGCGCCACC
AACATCCTCTACACTTTCGGCGGACACGCCGTCACTGTAGAGATCATGCACGCGATGTGG
AAGCCGCAGAAGTTCAAGTACATCTACCTGGTGGCGACGCTGTACGTGTTCACGCTGACG
CTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGCGACGCGCTGCTGACGCACTCGAAC
GCCTTCTCGCTGCTGCCGCGGTCCGGGTGGCGCGACGCGGCGGTGATCCTGATGCTGATC
CACCAGTTCATCACGTTCGGGTTCGCGTGCACCCCGCTCTACTTCGTGTGGGAGAAGGCG
ATCGGCATGCACGGCACCCGCAGCGTCCTCACCCGCGCGCTCGCCCGCCTCCCCATCGTC
GTGCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTC
GGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATCCCCTCCCTCTCCCACATCCTCACG
TACCGCTCCGCCTCCGCCAGATTGAATGCGGCGGAGAAGCCGCCGCCGTTCCTGCCGAGC
TGGAGCGGGATGTTCGTGGTGAACGTGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGGTTC
GGCCTCGGCGGCTGGGCCAGCGTCACCAACTTCATCAAGCAGATCGACACGTTCGGGCTC
TTCGCCAAGTGCTACCAGTGCCCACCCAGGGCGCACGCCGGGGCGCCCCTGCCGGCTCCG
CCGCGCCACTAG

Protein

504 aa

>Os05t0447200-01 Auxin influx carrier, Regulation of root development, Response to aluminium stress
MVPAGDQAEEAIVADAGKEEAEVRAAMGVEQDGKFSMTSLLWHGGSVWDAWFSCASNQVR
PTTNDLVMPLAHISFGILQVAQVLLTLPYSFSQLGMLSGLLLQVFYGLMGSWTAYLISVL
YVEYRARKEKEGVSFKNHVIQWFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASN
IYYINDRLDKRTWTYIFGACCSTTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAAAVHGQ
VDGVTHSGPSKMVLYFTGATNILYTFGGHAVTVEIMHAMWKPQKFKYIYLVATLYVFTLT
LPSASAMYWAFGDALLTHSNAFSLLPRSGWRDAAVILMLIHQFITFGFACTPLYFVWEKA
IGMHGTRSVLTRALARLPIVVPIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLSHILT
YRSASARLNAAEKPPPFLPSWSGMFVVNVFVVAWVLVVGFGLGGWASVTNFIKQIDTFGL
FAKCYQCPPRAHAGAPLPAPPRH*

5'UTR

chr05:21931642..21932028 (- strand) : 387 bp

chr05:21931510..21931549 (- strand) : 40 bp

CDS

chr05:21931087..21931509 (- strand) : 423 bp

chr05:21930607..21930719 (- strand) : 113 bp

chr05:21930324..21930507 (- strand) : 184 bp

chr05:21930041..21930138 (- strand) : 98 bp

chr05:21928176..21928641 (- strand) : 466 bp

chr05:21927238..21927465 (- strand) : 228 bp

3'UTR

chr05:21926917..21927237 (- strand) : 321 bp

FASTA

>Os05t0447200-01 class=Sequence position=chr05:21926917..21932028 (- strand)
TTCTCCCCTC CCACCGTCCC AACTCCCACG TCCGGCTCGG CTCGGGCCTC TCCGTGCCAG AGAGTTTCAC TCCTCGCGGA
GAAGGAAAAA CCGGAGGCGC GCGCGCAGTC GTGGCCGGGG TTGGGAAGAT CCGAGAGGCA AGGGGCAAGG GCGGCGTGCG
GGTCTGCAGG ATCAGGATCC CGAAAAGCTA GCCCGCGGCG AAGTAATAAT AACTGCTCCT CTGAATCTCT CCGATCCTCT
CGAACCACGA GAAGCTCAGC AGTTTCGGCT CCGCGCGCCG CCTGCCTCTC GGTCGACAGC ACAGTAAATT CCGCCGGCGC
GTGGTGCAGC TTTGCCGGCA GCGTGCCGCT CCCACGGCCA TTTACTTCGC CTCCTCTCCT GAGGCAGGTC GGTGTCGGTA
TTTATGTATA CTTGCACAGT TCCACTTCCC GGCCAGTCTC CTCACTCTCG ACTACTCTTC TTTGGTTTTT GCTGTGAAGG
CGCGCGGCTG GAGACGGGAA GACCGGGGAG GACAGGAGGA TGGTGCCGGC CGGCGACCAG GCGGAGGAGG CCATCGTGGC
GGACGCCGGG AAGGAGGAGG CGGAGGTGCG CGCGGCCATG GGCGTCGAGC AGGACGGCAA GTTCAGCATG ACGAGCCTCC
TGTGGCACGG CGGCTCCGTC TGGGACGCCT GGTTCAGCTG CGCCTCCAAC CAGGTACGAC CAACCACGAA CGACCTCGTC
ATGCCTCTCG CTCACATTTC GTTTGGAATT TTGCAGGTGG CGCAGGTGCT CCTGACGCTG CCGTACTCCT TCTCGCAGCT
CGGGATGCTC TCGGGCCTGC TGCTGCAGGT GTTCTACGGC CTCATGGGCA GCTGGACCGC CTACCTCATC AGCGTCCTCT
ACGTCGAGTA CCGCGCCCGC AAGGAGAAGG AAGGCGTCAG CTTCAAGAAC CACGTCATCC AGGTCGGCAG GGCTAGCTCC
TCTCCTTGCA CATCTTCGCG TCAGTTTCAG TTTCGTCAGT TTCCGGGTTT TCCTGCACAC ACTACTGCTT AATTATTTTC
CCCGACGGAA TTCGATCCCT CGTGATCGAT CTCATGCCGG TATTTCGAGC AGCGCCTGCG TGCGAGCGAG CGTTGCTTGT
CCAACGGAAA GCCGCTTTTG CATGCTCTCG CCTCCTGCAG GTTCCTTATC TGCAACGCGA TCAGCATGCA TATCTGCCTC
CAGCCAGCCT AGTGCACGCA TCAGATCAAC TGGCATATGG ATTAGACTAA ACTTAATATG GATTATCTAA AAATTTACTA
TTTTTGTGTT CTCTTATGCC ACTGACCAGT GGTTCGAAGT TCTTGATGGG CTCTTGGGCC CGTACTGGAA GGCGGCCGGC
CTCGCCTTCA ACTGCACCTT CCTGCTCTTC GGCTCCGTCA TCCAGCTGAT CGCCTGTGCA AGGTTGACTC GCCGAGTTCT
TGAGACAAAC ATACATACTC TTCTTTTTTT TTTTGTAATC TTTGTTCATT GAGATGTCAC TGAAATTGTA ATGCATTGCA
GTAACATATA CTACATCAAC GACCGGCTGG ACAAGAGGAC ATGGACGTAC ATATTCGGGG CGTGCTGCTC CACCACGGTG
TTCATCCCCT CCTTCCACAA CTACCGCATC TGGTCCTTCC TTGGCCTCGG CATGACCACC TACACCGCCT GGTACCTCGC
CATCGCCGCC GCCGTCCACG GCCAGGTGAG TCCTCGATCA TCGCCCGCCG TCGTCGGCCA TAAATCAATA AATCATCAGC
CGGCACATGC TTGACCACAC TGTTTATAAG CATGGTTGCA ATGATTATGT ATGATTCGAT TCGATGGGGG GCTAATAACG
ATGTGTATGA TTCGGCGTGG CCGCTGATCG AATTCGACTC GATGTCGCAG GTCGACGGCG TGACGCACTC GGGCCCGAGC
AAGATGGTGC TCTACTTCAC TGGCGCCACC AACATCCTCT ACACTTTCGG CGGACACGCC GTCACTGTGT AAGTGCACTA
AAAGAACCCT ATGCTACTGT AAATTGTGAC GCATAAACCA TGCAATGCCT CTGCTAATTT TGTCATGAAT GGTTATCGAC
AACTGGGTCC AGTGTCCAAG CCAGAATTCC GGAGAGCCAT CTATGAAACA ATGATGTTCG TTGTTACCTA CCCTAGATTT
AGTCTGGTTT CTGTTTTATC TTTAGTCTCT CCCTCCTTGG CAAACTTGTT TAATTTACGG AAACCAGAAG GGTTATCTTC
TAGCCATTGG TTACAAAGAA ATGGAGCATA TAGCCACTAA GGTTGGCGAT CACCCTACAG TCCTCTGCTC AAGTTCCTAT
GATGACCACC AAGCATTTCA ATACTCCTAG TGAACATTCC TTTATTCCCG TTGTCCATTT CTTGTGCTTA ATCTAAGATA
CCTGCTATGA TGATCTTTGC ATCGCGATTA TTAGGAATAA TTAGAACCAG TGAGATGTTC AGACGCCCTG GTATTAAATA
TTGAGTCCTT TGTCTTTAAA ATTCAGCTAC TTTTTTTGTA GTGGTAAAAA TGTTCTTTCC AAAGGGTAGA TGATATGGAT
TGGTTTCAGT CCAGCTAGTG CGGAGTTAAC ATCGAATAAA CCAATCCCGC CCAACTTCAG TGATAGCCTG GTAGGACATA
TATCGGATCG TGACAATTCA TTAACTGATC GGTTATGGTT CACGATTCCA TTTTATCTTT CCGTGATAAC CTTTGATTAG
TGCAGTGAAA GACTACTTTG AGAATTCCTT CCCTACTCCC AAGTGTCAGT TTGACATTAC CCTTCTCGAT CGATCACAGT
TTCTTGCCCA AAGCAATTCA GGGCTTTTTG AGTGATGAGT GATGACAGTA ATTGCCATTA CCTGAGAGTG TTAGGTGCTT
GTAATCGGCA AGTAGCTTCA TTTGGTCGTA TTTGTCGGTC CCCCTCTGCT TACTTACCAT CACCAGATGT GTGTCCGCGT
CTGTGCAGCC GAATGATGTA GTGAAAGTTT GGGGATAATG GGAGATTCCT CATGTCCCAA TCTTTATAAA TATCCTGACT
AGGATAAGCA CTACCTTGCC CCCCTGCTTG ATCTCTTATC ATTCAATCAA CTTAAAGTAA AGTTCTTATA TATCACTTGG
CATGTGTATG AAAAATGTCC GTTTAGTACG TTTTGTTCCA AGCGGGGCTA ATTCTGATAG CTTCATATAT GTTACTAGTA
CTGATATTAT TATTATTTAA GATAAGATGA ACAATTTCTT ATTTTGCATA ATCAAATAAT CTGTACATGC ATGCTGAATT
AGAGATTGTG CTGTTGATCG GTTCACGATG AACGAAGCTG ACAGTGAACA ATCGTGCCTG AAGTTCTGAA CAGTTGACGA
AGTTTAATTA ACTTTTTACG CGTGCAGAGA GATCATGCAC GCGATGTGGA AGCCGCAGAA GTTCAAGTAC ATCTACCTGG
TGGCGACGCT GTACGTGTTC ACGCTGACGC TGCCGTCGGC GTCGGCCATG TACTGGGCGT TCGGCGACGC GCTGCTGACG
CACTCGAACG CCTTCTCGCT GCTGCCGCGG TCCGGGTGGC GCGACGCGGC GGTGATCCTG ATGCTGATCC ACCAGTTCAT
CACGTTCGGG TTCGCGTGCA CCCCGCTCTA CTTCGTGTGG GAGAAGGCGA TCGGCATGCA CGGCACCCGC AGCGTCCTCA
CCCGCGCGCT CGCCCGCCTC CCCATCGTCG TGCCCATCTG GTTCCTCGCC ATCATCTTCC CCTTCTTCGG CCCCATCAAC
TCCGCCGTCG GCGCGCTCCT CGTCAGCTTC ACCGTCTACA TCATCCCCTC CCTCTCCCAC ATCCTCACGT ACCGCTCCGC
CTCCGCCAGA TTGGTAAGTG TGTGCAGCTA CCTTTGCCTT TTCTTTACTT ACCATTAAAT TGCCCGAGTA GATTCCTCAT
ATATCAATAT GAAACATGCA CTGTTTGTCT AAAAAAATTT AAAAATATCC GAGTAGAAAT CGGGCTGTCA GTCGGTCACC
AGTGCCAAAG TGACACAACC ACACATTACA CTACACCAAG GCACTCTTAT GCTAGCTAGG ATGCTACACG CATGAGCAGA
ACGGCTGGGT ATTGCATATT GGCACGGATT ATTGGTAAGC ACTGTGCAGA TATGGAATGG CCCCCACAAG TACTGTGATC
AAAGTAAGTG TAGCCTTCCA CTATGGCACC AAAGCACTAG TGCCACACGC ACGAACAGCG CCGTGACGCC GAGAGCGCTC
TCCCTGTGCT GCTCCGGCCA AACACCGACA GGCTCTCGGT CTCTGGTGCC CCCCAACAAC GACGGCGCGG CCACGCGGAT
CGGCGCCGGT TTATTTGGTC GGGTACGCCT GCTCGATCGG TCGGCGGCGA CAGGGATGGC CGGGGCTGAC GGGTCGCTGT
CGCTGTTCCG CCTTTCTCCG GCTGTGCCGG CCCCCGGCAC GTACGCCTGG ACCGTATACC TTATCACGCA GCTCGCCGGC
AGGCGGCAGC ACGGCGTGAA GGTCATATCT GCGCAACATC AACTGACGTA CAGCGTGTTT GATTTTTTTT TTTATGCAAA
CAGAATGCGG CGGAGAAGCC GCCGCCGTTC CTGCCGAGCT GGAGCGGGAT GTTCGTGGTG AACGTGTTCG TGGTGGCGTG
GGTGCTGGTG GTCGGGTTCG GCCTCGGCGG CTGGGCCAGC GTCACCAACT TCATCAAGCA GATCGACACG TTCGGGCTCT
TCGCCAAGTG CTACCAGTGC CCACCCAGGG CGCACGCCGG GGCGCCCCTG CCGGCTCCGC CGCGCCACTA GCCAAAAAAA
CCGAGTGCCA CGCCGCGACG GCGCGACGCC GCGCGCGGGC CGGTGACAAA AGGAGCTAGC TTCCCCGCGG GCGTCTTGCC
TTTGTGTAGT AGGACAGCAG GTCAGCAGCA TACATGGTAG GACAGCGCGT GGGTCACTGA CTAGATTTAC CGCCCTGCAG
GGGCTTCCCT ATGCTGCGGA GTCTTCAGTT CATGTGTGTT GTTGGCAACT TTGCGTCGTC CTCTTTTGTT TGGGAGTTGG
ATGTGAACTT GGTCGTAATT TGTAGGTTCT TCTGTTCATG TTACATGCCA ATATAAAACG CCATATTTGT TC

Locus: Os05g0447200

Loading...

Locus: Os05g0447200

Loading...