Os05t0447200-02

Locus

Os05g0447200

Description

Similar to AUX1-like protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLAX3, OsRAU3, OsAUX2, LAX3, RAU3, AUX2, OsAUX3, AUX3, ARF2

Oryzabase Gene Name Synonym(s)

like aux1-3, related to AUX1-3, auxin transporter 2

Transcript Evidence

AK111849 (DDBJ, Best hit)

Protein Evidence

B7F409 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Amino acid transporter, transmembrane (IPR013057)

Full-length cDNA

J023145B14 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0447200-02)

RiceXPro (AK111849)

Others

Oryzabase (11918)

KEGG (Os05t0447200-02)

Transcript

1960 bp

>Os05t0447200-02 Similar to AUX1-like protein.
TCTCGAACCACGAGAAGCTCAGCAGTTTCGGCTCCGCGCGCCGCCTGCCTCTCGGTCGAC
AGCACAGTAAATTCCGCCGGCGCGTGGTGCAGCTTTGCCGGCAGCGTGCCGCTCCCACGG
CCATTTACTTCGCCTCCTCTCCTGAGGCAGGCGCGCGGCTGGAGACGGGAAGACCGGGGA
GGACAGGAGGATGGTGCCGGCCGGCGACCAGGCGGAGGAGGCCATCGTGGCGGACGCCGG
GAAGGAGGAGGCGGAGGTGCGCGCGGCCATGGGCGTCGAGCAGGACGGCAAGTTCAGCAT
GACGAGCCTCCTGTGGCACGGCGGCTCCGTCTGGGACGCCTGGTTCAGCTGCGCCTCCAA
CCAGGTGGCGCAGGTGCTCCTGACGCTGCCGTACTCCTTCTCGCAGCTCGGGATGCTCTC
GGGCCTGCTGCTGCAGGTGTTCTACGGCCTCATGGGCAGCTGGACCGCCTACCTCATCAG
CGTCCTCTACGTCGAGTACCGCGCCCGCAAGGAGAAGGAAGGCGTCAGCTTCAAGAACCA
CGTCATCCAGTGGTTCGAAGTTCTTGATGGGCTCTTGGGCCCGTACTGGAAGGCGGCCGG
CCTCGCCTTCAACTGCACCTTCCTGCTCTTCGGCTCCGTCATCCAGCTGATCGCCTGTGC
AAGTAACATATACTACATCAACGACCGGCTGGACAAGAGGACATGGACGTACATATTCGG
GGCGTGCTGCTCCACCACGGTGTTCATCCCCTCCTTCCACAACTACCGCATCTGGTCCTT
CCTTGGCCTCGGCATGACCACCTACACCGCCTGGTACCTCGCCATCGCCGCCGCCGTCCA
CGGCCAGGTCGACGGCGTGACGCACTCGGGCCCGAGCAAGATGGTGCTCTACTTCACTGG
CGCCACCAACATCCTCTACACTTTCGGCGGACACGCCGTCACTGTAGAGATCATGCACGC
GATGTGGAAGCCGCAGAAGTTCAAGTACATCTACCTGGTGGCGACGCTGTACGTGTTCAC
GCTGACGCTGCCGTCGGCGTCGGCCATGTACTGGGCGTTCGGCGACGCGCTGCTGACGCA
CTCGAACGCCTTCTCGCTGCTGCCGCGGTCCGGGTGGCGCGACGCGGCGGTGATCCTGAT
GCTGATCCACCAGTTCATCACGTTCGGGTTCGCGTGCACCCCGCTCTACTTCGTGTGGGA
GAAGGCGATCGGCATGCACGGCACCCGCAGCGTCCTCACCCGCGCGCTCGCCCGCCTCCC
CATCGTCGTGCCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTC
CGCCGTCGGCGCGCTCCTCGTCAGCTTCACCGTCTACATCATCCCCTCCCTCTCCCACAT
CCTCACGTACCGCTCCGCCTCCGCCAGATTGAATGCGGCGGAGAAGCCGCCGCCGTTCCT
GCCGAGCTGGAGCGGGATGTTCGTGGTGAACGTGTTCGTGGTGGCGTGGGTGCTGGTGGT
CGGGTTCGGCCTCGGCGGCTGGGCCAGCGTCACCAACTTCATCAAGCAGATCGACACGTT
CGGGCTCTTCGCCAAGTGCTACCAGTGCCCACCCAGGGCGCACGCCGGGGCGCCCCTGCC
GGCTCCGCCGCGCCACTAGCCAAAAAAACCGAGTGCCACGCCGCGACGGCGCGACGCCGC
GCGCGGGCCGGTGACAAAAGGAGCTAGCTTCCCCGCGGGCGTCTTGCCTTTGTGTAGTAG
GACAGCAGGTCAGCAGCATACATGGTAGGACAGCGCGTGGGTCACTGACTAGATTTACCG
CCCTGCAGGGGCTTCCCTATGCTGCGGAGTCTTCAGTTCATGTGTGTTGTTGGCAACTTT
GCGTCGTCCTCTTTTGTTTGGGAGTTGGATGTGAACTTGGTCGTAATTTGTAGGTTCTTC
TGTTCATGTTACATGCCAATATAAAACGCCATATTTGTTC

CDS

1449 bp

>Os05t0447200-02 Similar to AUX1-like protein.
ATGGTGCCGGCCGGCGACCAGGCGGAGGAGGCCATCGTGGCGGACGCCGGGAAGGAGGAG
GCGGAGGTGCGCGCGGCCATGGGCGTCGAGCAGGACGGCAAGTTCAGCATGACGAGCCTC
CTGTGGCACGGCGGCTCCGTCTGGGACGCCTGGTTCAGCTGCGCCTCCAACCAGGTGGCG
CAGGTGCTCCTGACGCTGCCGTACTCCTTCTCGCAGCTCGGGATGCTCTCGGGCCTGCTG
CTGCAGGTGTTCTACGGCCTCATGGGCAGCTGGACCGCCTACCTCATCAGCGTCCTCTAC
GTCGAGTACCGCGCCCGCAAGGAGAAGGAAGGCGTCAGCTTCAAGAACCACGTCATCCAG
TGGTTCGAAGTTCTTGATGGGCTCTTGGGCCCGTACTGGAAGGCGGCCGGCCTCGCCTTC
AACTGCACCTTCCTGCTCTTCGGCTCCGTCATCCAGCTGATCGCCTGTGCAAGTAACATA
TACTACATCAACGACCGGCTGGACAAGAGGACATGGACGTACATATTCGGGGCGTGCTGC
TCCACCACGGTGTTCATCCCCTCCTTCCACAACTACCGCATCTGGTCCTTCCTTGGCCTC
GGCATGACCACCTACACCGCCTGGTACCTCGCCATCGCCGCCGCCGTCCACGGCCAGGTC
GACGGCGTGACGCACTCGGGCCCGAGCAAGATGGTGCTCTACTTCACTGGCGCCACCAAC
ATCCTCTACACTTTCGGCGGACACGCCGTCACTGTAGAGATCATGCACGCGATGTGGAAG
CCGCAGAAGTTCAAGTACATCTACCTGGTGGCGACGCTGTACGTGTTCACGCTGACGCTG
CCGTCGGCGTCGGCCATGTACTGGGCGTTCGGCGACGCGCTGCTGACGCACTCGAACGCC
TTCTCGCTGCTGCCGCGGTCCGGGTGGCGCGACGCGGCGGTGATCCTGATGCTGATCCAC
CAGTTCATCACGTTCGGGTTCGCGTGCACCCCGCTCTACTTCGTGTGGGAGAAGGCGATC
GGCATGCACGGCACCCGCAGCGTCCTCACCCGCGCGCTCGCCCGCCTCCCCATCGTCGTG
CCCATCTGGTTCCTCGCCATCATCTTCCCCTTCTTCGGCCCCATCAACTCCGCCGTCGGC
GCGCTCCTCGTCAGCTTCACCGTCTACATCATCCCCTCCCTCTCCCACATCCTCACGTAC
CGCTCCGCCTCCGCCAGATTGAATGCGGCGGAGAAGCCGCCGCCGTTCCTGCCGAGCTGG
AGCGGGATGTTCGTGGTGAACGTGTTCGTGGTGGCGTGGGTGCTGGTGGTCGGGTTCGGC
CTCGGCGGCTGGGCCAGCGTCACCAACTTCATCAAGCAGATCGACACGTTCGGGCTCTTC
GCCAAGTGCTACCAGTGCCCACCCAGGGCGCACGCCGGGGCGCCCCTGCCGGCTCCGCCG
CGCCACTAG

Protein

483 aa

>Os05t0447200-02 Similar to AUX1-like protein.
MVPAGDQAEEAIVADAGKEEAEVRAAMGVEQDGKFSMTSLLWHGGSVWDAWFSCASNQVA
QVLLTLPYSFSQLGMLSGLLLQVFYGLMGSWTAYLISVLYVEYRARKEKEGVSFKNHVIQ
WFEVLDGLLGPYWKAAGLAFNCTFLLFGSVIQLIACASNIYYINDRLDKRTWTYIFGACC
STTVFIPSFHNYRIWSFLGLGMTTYTAWYLAIAAAVHGQVDGVTHSGPSKMVLYFTGATN
ILYTFGGHAVTVEIMHAMWKPQKFKYIYLVATLYVFTLTLPSASAMYWAFGDALLTHSNA
FSLLPRSGWRDAAVILMLIHQFITFGFACTPLYFVWEKAIGMHGTRSVLTRALARLPIVV
PIWFLAIIFPFFGPINSAVGALLVSFTVYIIPSLSHILTYRSASARLNAAEKPPPFLPSW
SGMFVVNVFVVAWVLVVGFGLGGWASVTNFIKQIDTFGLFAKCYQCPPRAHAGAPLPAPP
RH*

5'UTR

chr05:21931642..21931791 (- strand) : 150 bp

chr05:21931510..21931549 (- strand) : 40 bp

CDS

chr05:21931336..21931509 (- strand) : 174 bp

chr05:21931087..21931272 (- strand) : 186 bp

chr05:21930607..21930719 (- strand) : 113 bp

chr05:21930324..21930507 (- strand) : 184 bp

chr05:21930041..21930138 (- strand) : 98 bp

chr05:21928176..21928641 (- strand) : 466 bp

chr05:21927238..21927465 (- strand) : 228 bp

3'UTR

chr05:21926917..21927237 (- strand) : 321 bp

FASTA

>Os05t0447200-02 class=Sequence position=chr05:21926917..21931791 (- strand)
TCTCGAACCA CGAGAAGCTC AGCAGTTTCG GCTCCGCGCG CCGCCTGCCT CTCGGTCGAC AGCACAGTAA ATTCCGCCGG
CGCGTGGTGC AGCTTTGCCG GCAGCGTGCC GCTCCCACGG CCATTTACTT CGCCTCCTCT CCTGAGGCAG GTCGGTGTCG
GTATTTATGT ATACTTGCAC AGTTCCACTT CCCGGCCAGT CTCCTCACTC TCGACTACTC TTCTTTGGTT TTTGCTGTGA
AGGCGCGCGG CTGGAGACGG GAAGACCGGG GAGGACAGGA GGATGGTGCC GGCCGGCGAC CAGGCGGAGG AGGCCATCGT
GGCGGACGCC GGGAAGGAGG AGGCGGAGGT GCGCGCGGCC ATGGGCGTCG AGCAGGACGG CAAGTTCAGC ATGACGAGCC
TCCTGTGGCA CGGCGGCTCC GTCTGGGACG CCTGGTTCAG CTGCGCCTCC AACCAGGTAC GACCAACCAC GAACGACCTC
GTCATGCCTC TCGCTCACAT TTCGTTTGGA ATTTTGCAGG TGGCGCAGGT GCTCCTGACG CTGCCGTACT CCTTCTCGCA
GCTCGGGATG CTCTCGGGCC TGCTGCTGCA GGTGTTCTAC GGCCTCATGG GCAGCTGGAC CGCCTACCTC ATCAGCGTCC
TCTACGTCGA GTACCGCGCC CGCAAGGAGA AGGAAGGCGT CAGCTTCAAG AACCACGTCA TCCAGGTCGG CAGGGCTAGC
TCCTCTCCTT GCACATCTTC GCGTCAGTTT CAGTTTCGTC AGTTTCCGGG TTTTCCTGCA CACACTACTG CTTAATTATT
TTCCCCGACG GAATTCGATC CCTCGTGATC GATCTCATGC CGGTATTTCG AGCAGCGCCT GCGTGCGAGC GAGCGTTGCT
TGTCCAACGG AAAGCCGCTT TTGCATGCTC TCGCCTCCTG CAGGTTCCTT ATCTGCAACG CGATCAGCAT GCATATCTGC
CTCCAGCCAG CCTAGTGCAC GCATCAGATC AACTGGCATA TGGATTAGAC TAAACTTAAT ATGGATTATC TAAAAATTTA
CTATTTTTGT GTTCTCTTAT GCCACTGACC AGTGGTTCGA AGTTCTTGAT GGGCTCTTGG GCCCGTACTG GAAGGCGGCC
GGCCTCGCCT TCAACTGCAC CTTCCTGCTC TTCGGCTCCG TCATCCAGCT GATCGCCTGT GCAAGGTTGA CTCGCCGAGT
TCTTGAGACA AACATACATA CTCTTCTTTT TTTTTTTGTA ATCTTTGTTC ATTGAGATGT CACTGAAATT GTAATGCATT
GCAGTAACAT ATACTACATC AACGACCGGC TGGACAAGAG GACATGGACG TACATATTCG GGGCGTGCTG CTCCACCACG
GTGTTCATCC CCTCCTTCCA CAACTACCGC ATCTGGTCCT TCCTTGGCCT CGGCATGACC ACCTACACCG CCTGGTACCT
CGCCATCGCC GCCGCCGTCC ACGGCCAGGT GAGTCCTCGA TCATCGCCCG CCGTCGTCGG CCATAAATCA ATAAATCATC
AGCCGGCACA TGCTTGACCA CACTGTTTAT AAGCATGGTT GCAATGATTA TGTATGATTC GATTCGATGG GGGGCTAATA
ACGATGTGTA TGATTCGGCG TGGCCGCTGA TCGAATTCGA CTCGATGTCG CAGGTCGACG GCGTGACGCA CTCGGGCCCG
AGCAAGATGG TGCTCTACTT CACTGGCGCC ACCAACATCC TCTACACTTT CGGCGGACAC GCCGTCACTG TGTAAGTGCA
CTAAAAGAAC CCTATGCTAC TGTAAATTGT GACGCATAAA CCATGCAATG CCTCTGCTAA TTTTGTCATG AATGGTTATC
GACAACTGGG TCCAGTGTCC AAGCCAGAAT TCCGGAGAGC CATCTATGAA ACAATGATGT TCGTTGTTAC CTACCCTAGA
TTTAGTCTGG TTTCTGTTTT ATCTTTAGTC TCTCCCTCCT TGGCAAACTT GTTTAATTTA CGGAAACCAG AAGGGTTATC
TTCTAGCCAT TGGTTACAAA GAAATGGAGC ATATAGCCAC TAAGGTTGGC GATCACCCTA CAGTCCTCTG CTCAAGTTCC
TATGATGACC ACCAAGCATT TCAATACTCC TAGTGAACAT TCCTTTATTC CCGTTGTCCA TTTCTTGTGC TTAATCTAAG
ATACCTGCTA TGATGATCTT TGCATCGCGA TTATTAGGAA TAATTAGAAC CAGTGAGATG TTCAGACGCC CTGGTATTAA
ATATTGAGTC CTTTGTCTTT AAAATTCAGC TACTTTTTTT GTAGTGGTAA AAATGTTCTT TCCAAAGGGT AGATGATATG
GATTGGTTTC AGTCCAGCTA GTGCGGAGTT AACATCGAAT AAACCAATCC CGCCCAACTT CAGTGATAGC CTGGTAGGAC
ATATATCGGA TCGTGACAAT TCATTAACTG ATCGGTTATG GTTCACGATT CCATTTTATC TTTCCGTGAT AACCTTTGAT
TAGTGCAGTG AAAGACTACT TTGAGAATTC CTTCCCTACT CCCAAGTGTC AGTTTGACAT TACCCTTCTC GATCGATCAC
AGTTTCTTGC CCAAAGCAAT TCAGGGCTTT TTGAGTGATG AGTGATGACA GTAATTGCCA TTACCTGAGA GTGTTAGGTG
CTTGTAATCG GCAAGTAGCT TCATTTGGTC GTATTTGTCG GTCCCCCTCT GCTTACTTAC CATCACCAGA TGTGTGTCCG
CGTCTGTGCA GCCGAATGAT GTAGTGAAAG TTTGGGGATA ATGGGAGATT CCTCATGTCC CAATCTTTAT AAATATCCTG
ACTAGGATAA GCACTACCTT GCCCCCCTGC TTGATCTCTT ATCATTCAAT CAACTTAAAG TAAAGTTCTT ATATATCACT
TGGCATGTGT ATGAAAAATG TCCGTTTAGT ACGTTTTGTT CCAAGCGGGG CTAATTCTGA TAGCTTCATA TATGTTACTA
GTACTGATAT TATTATTATT TAAGATAAGA TGAACAATTT CTTATTTTGC ATAATCAAAT AATCTGTACA TGCATGCTGA
ATTAGAGATT GTGCTGTTGA TCGGTTCACG ATGAACGAAG CTGACAGTGA ACAATCGTGC CTGAAGTTCT GAACAGTTGA
CGAAGTTTAA TTAACTTTTT ACGCGTGCAG AGAGATCATG CACGCGATGT GGAAGCCGCA GAAGTTCAAG TACATCTACC
TGGTGGCGAC GCTGTACGTG TTCACGCTGA CGCTGCCGTC GGCGTCGGCC ATGTACTGGG CGTTCGGCGA CGCGCTGCTG
ACGCACTCGA ACGCCTTCTC GCTGCTGCCG CGGTCCGGGT GGCGCGACGC GGCGGTGATC CTGATGCTGA TCCACCAGTT
CATCACGTTC GGGTTCGCGT GCACCCCGCT CTACTTCGTG TGGGAGAAGG CGATCGGCAT GCACGGCACC CGCAGCGTCC
TCACCCGCGC GCTCGCCCGC CTCCCCATCG TCGTGCCCAT CTGGTTCCTC GCCATCATCT TCCCCTTCTT CGGCCCCATC
AACTCCGCCG TCGGCGCGCT CCTCGTCAGC TTCACCGTCT ACATCATCCC CTCCCTCTCC CACATCCTCA CGTACCGCTC
CGCCTCCGCC AGATTGGTAA GTGTGTGCAG CTACCTTTGC CTTTTCTTTA CTTACCATTA AATTGCCCGA GTAGATTCCT
CATATATCAA TATGAAACAT GCACTGTTTG TCTAAAAAAA TTTAAAAATA TCCGAGTAGA AATCGGGCTG TCAGTCGGTC
ACCAGTGCCA AAGTGACACA ACCACACATT ACACTACACC AAGGCACTCT TATGCTAGCT AGGATGCTAC ACGCATGAGC
AGAACGGCTG GGTATTGCAT ATTGGCACGG ATTATTGGTA AGCACTGTGC AGATATGGAA TGGCCCCCAC AAGTACTGTG
ATCAAAGTAA GTGTAGCCTT CCACTATGGC ACCAAAGCAC TAGTGCCACA CGCACGAACA GCGCCGTGAC GCCGAGAGCG
CTCTCCCTGT GCTGCTCCGG CCAAACACCG ACAGGCTCTC GGTCTCTGGT GCCCCCCAAC AACGACGGCG CGGCCACGCG
GATCGGCGCC GGTTTATTTG GTCGGGTACG CCTGCTCGAT CGGTCGGCGG CGACAGGGAT GGCCGGGGCT GACGGGTCGC
TGTCGCTGTT CCGCCTTTCT CCGGCTGTGC CGGCCCCCGG CACGTACGCC TGGACCGTAT ACCTTATCAC GCAGCTCGCC
GGCAGGCGGC AGCACGGCGT GAAGGTCATA TCTGCGCAAC ATCAACTGAC GTACAGCGTG TTTGATTTTT TTTTTTATGC
AAACAGAATG CGGCGGAGAA GCCGCCGCCG TTCCTGCCGA GCTGGAGCGG GATGTTCGTG GTGAACGTGT TCGTGGTGGC
GTGGGTGCTG GTGGTCGGGT TCGGCCTCGG CGGCTGGGCC AGCGTCACCA ACTTCATCAA GCAGATCGAC ACGTTCGGGC
TCTTCGCCAA GTGCTACCAG TGCCCACCCA GGGCGCACGC CGGGGCGCCC CTGCCGGCTC CGCCGCGCCA CTAGCCAAAA
AAACCGAGTG CCACGCCGCG ACGGCGCGAC GCCGCGCGCG GGCCGGTGAC AAAAGGAGCT AGCTTCCCCG CGGGCGTCTT
GCCTTTGTGT AGTAGGACAG CAGGTCAGCA GCATACATGG TAGGACAGCG CGTGGGTCAC TGACTAGATT TACCGCCCTG
CAGGGGCTTC CCTATGCTGC GGAGTCTTCA GTTCATGTGT GTTGTTGGCA ACTTTGCGTC GTCCTCTTTT GTTTGGGAGT
TGGATGTGAA CTTGGTCGTA ATTTGTAGGT TCTTCTGTTC ATGTTACATG CCAATATAAA ACGCCATATT TGTTC

Locus: Os05g0447200

Loading...

Locus: Os05g0447200

Loading...