Os05t0453900-00

Locus

Os05g0453900

Description

Similar to DNA replication complex GINS protein PSF1.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PSF1

CGSNL Gene Name

PARTNER OF SLD FIVE 1

Oryzabase Gene Symbol Synonym(s)

PSF1

Oryzabase Gene Name Synonym(s)

partner of Sld five 1

Transcript Evidence

BT060471 (DDBJ)

Protein Evidence

NP_001149745.1 (RefSeq)

Literature

Note

Manual Curation

Functional domain (InterPro)

GINS complex, subunit Psf1 (IPR005339)

GINS complex (IPR021151)

Expression Databases

TENOR (Os05t0453900-00)

Others

Oryzabase (7452)

KEGG (Os05t0453900-00)

Transcript

627 bp

>Os05t0453900-00 Similar to DNA replication complex GINS protein PSF1.
GAGGAGGATGTACGGGCGGCGCGCGTCGCAGCTGCTGAAGGAGGTCGACTCCTGCGAGGC
CGGACAGCTCGTGCCGTTCAACAGCGATGTGTTTGATCAGGTTATTAGAGAGTGCAATGA
ACACAATACACAGTTTCAGTCATTGATAAGGAAAATGGTGGAGCAGAACTTAGACATTGA
AACAACCAGAAATGACGACCACTATGGGGCAGCCGTCCATCATCTTTCGCTGCTTCGTAA
CAAAAGATGTCTCATGGCTTACATGTATAACCGAGCAGAGGTTATTCAGAGCTTTAGATG
GAAAATCGGCCCAGTGCTTCCTCATGAAATACAAGAAAAGCTCCATTTTTCTGAGAAAGA
GTACTTCAAGAACCACTCAGCAGCCATTAAATCATATATGTCAGAGATGGATATAGATTT
AACAGTGGACATGGTGCCTCCCAAGGATCCCTACATCCAGGTTCGGGTGCTTGAGGACAT
TGGTGAAGTATCTCTTGGTGACCATTCCATATCATTGACAAAGAACTCACTTCATTTCCT
AAGGCGCACTGATACTGAACAATTTATATCACAGGGTCTTATGGAAGAGTTTCTGGAGTA
GAGATCACATATGGTGTACAATAGGTA

CDS

594 bp

>Os05t0453900-00 Similar to DNA replication complex GINS protein PSF1.
ATGTACGGGCGGCGCGCGTCGCAGCTGCTGAAGGAGGTCGACTCCTGCGAGGCCGGACAG
CTCGTGCCGTTCAACAGCGATGTGTTTGATCAGGTTATTAGAGAGTGCAATGAACACAAT
ACACAGTTTCAGTCATTGATAAGGAAAATGGTGGAGCAGAACTTAGACATTGAAACAACC
AGAAATGACGACCACTATGGGGCAGCCGTCCATCATCTTTCGCTGCTTCGTAACAAAAGA
TGTCTCATGGCTTACATGTATAACCGAGCAGAGGTTATTCAGAGCTTTAGATGGAAAATC
GGCCCAGTGCTTCCTCATGAAATACAAGAAAAGCTCCATTTTTCTGAGAAAGAGTACTTC
AAGAACCACTCAGCAGCCATTAAATCATATATGTCAGAGATGGATATAGATTTAACAGTG
GACATGGTGCCTCCCAAGGATCCCTACATCCAGGTTCGGGTGCTTGAGGACATTGGTGAA
GTATCTCTTGGTGACCATTCCATATCATTGACAAAGAACTCACTTCATTTCCTAAGGCGC
ACTGATACTGAACAATTTATATCACAGGGTCTTATGGAAGAGTTTCTGGAGTAG

Protein

198 aa

>Os05t0453900-00 Similar to DNA replication complex GINS protein PSF1.
MYGRRASQLLKEVDSCEAGQLVPFNSDVFDQVIRECNEHNTQFQSLIRKMVEQNLDIETT
RNDDHYGAAVHHLSLLRNKRCLMAYMYNRAEVIQSFRWKIGPVLPHEIQEKLHFSEKEYF
KNHSAAIKSYMSEMDIDLTVDMVPPKDPYIQVRVLEDIGEVSLGDHSISLTKNSLHFLRR
TDTEQFISQGLMEEFLE*

5'UTR

chr05:22281707..22281713 (+ strand) : 7 bp

CDS

chr05:22281714..22281788 (+ strand) : 75 bp

chr05:22282278..22282345 (+ strand) : 68 bp

chr05:22282547..22282660 (+ strand) : 114 bp

chr05:22282775..22282937 (+ strand) : 163 bp

chr05:22283014..22283160 (+ strand) : 147 bp

chr05:22283238..22283264 (+ strand) : 27 bp

3'UTR

chr05:22283265..22283290 (+ strand) : 26 bp

FASTA

>Os05t0453900-00 class=Sequence position=chr05:22281707..22283290 (+ strand)
GAGGAGGATG TACGGGCGGC GCGCGTCGCA GCTGCTGAAG GAGGTCGACT CCTGCGAGGC CGGACAGCTC GTGCCGTTCA
ACGTAAGTTT CTACCCCCCC CCCCCCCTAA GCGCTCGCGT TTCTTAGCTC TGGGGATCTG AGTGGCCGGT GATTAGGTTT
CGTTTGTGGC TATTTTTAGG GCGGAATTAT GGTTGGTCTA GCTGCATAGT TGAAATTGAG TTCATAAATG TGCATTTTCA
ATCCTACGGG GGGAATGTTA TCTGCATGGT GTATAACTAT CAGGCGACAG TTTAAATTTA AACGATTTGG CTTTTCGGTC
TGGTTTGCAA AATTGTATGT AATTTGTGAG CTTTCATTTG TCTATCTTGA TGATGAAATC TAGTTCTGAA ATATACTGAG
CTTGCAAATT GCAATCACAT GAAAGCACAT AAAGTCTGGG GCTGGTGGTC TGGTGGGGGT TAATGTAAGT TAAGATTACC
GTTCCTGTGA TGTGACTGTG GCAGCATAGT TTAATTAGTT CGGTTAGTTA TTATGCTTGG TCCCTAACTT CTTTTTCTTA
TGGATGTGCA GAGCGATGTG TTTGATCAGG TTATTAGAGA GTGCAATGAA CACAATACAC AGTTTCAGTC ATTGATAAGG
TAAATTGCTT CCTATCAGAA AATTGATCAT CTTCATCTAG TTCTGCAATA AGAGTTATGA TCAATTAATC AATTTCTAGG
ATGTATTTCA CAGGAAAAAC AGCACAGAAC TATATCAAAC TAATAAAACT CTTACTTGAC TTCTTCACCA TTACAGTTTA
CTTAATTTTG ATTGCCTGAT TTGCATTGTG TTTATGACAG GAAAATGGTG GAGCAGAACT TAGACATTGA AACAACCAGA
AATGACGACC ACTATGGGGC AGCCGTCCAT CATCTTTCGC TGCTTCGTAA CAAAAGATGT CTCATGGCTT ACATGTACAA
GACTGAAATC TCACAGCTGA ACAAACTTTT TACTTTCTAT GTTTTATGCT GATTTTACAT GCACGCACTA ATTTTGAGTA
TGGAACTGAA AGCACTGAGT TCAATCAGGT ATAACCGAGC AGAGGTTATT CAGAGCTTTA GATGGAAAAT CGGCCCAGTG
CTTCCTCATG AAATACAAGA AAAGCTCCAT TTTTCTGAGA AAGAGTACTT CAAGAACCAC TCAGCAGCCA TTAAATCATA
TATGTCAGAG ATGGATATAG ATTTAACAGT GGTACAGCAT TTTTCTGTTT TATTTACTTT CTTTTGGATG AAATACAGTT
AGCAGATTTT CTGTACCACT TCTATAGGAC ATGGTGCCTC CCAAGGATCC CTACATCCAG GTTCGGGTGC TTGAGGACAT
TGGTGAAGTA TCTCTTGGTG ACCATTCCAT ATCATTGACA AAGAACTCAC TTCATTTCCT AAGGCGCACT GATACTGAAC
AATTTATATC ACAGGTTTGC TATCTTACTT TTGTGATATT CTCAGTGTGT TTATTCCATC TGCTAATAAT GTTCTATCAA
ACTTACAATA GGGTCTTATG GAAGAGTTTC TGGAGTAGAG ATCACATATG GTGTACAATA GGTA

Locus: Os05g0453900

Loading...

Locus: Os05g0453900

Loading...