Os05t0454200-01

Locus

Os05g0454200

Description

Guanine nucleotide exchange factors for Rop, Activation of small cuticular papillae development on leaf epidermis

RAP-DB Gene Symbol Synonym(s)

BGL, OsRopGEF10, bgl

RAP-DB Gene Name Synonym(s)

BRIGHT GREEN LEAF, bright green leaf, guanine nucleotide exchange factor for Rop 10

CGSNL Gene Symbol

BGL

CGSNL Gene Name

BRIGHT GREEN LEAF

Oryzabase Gene Symbol Synonym(s)

bgl, OsRopGEF10, Os RopGEF10, RopGEF10

Oryzabase Gene Name Synonym(s)

bright green leaf, guanine nucleotide exchange factor for Rop 10, GEF for ROP 10, Rop-specific GEF10, Rop-specific guanine nucleotide exchange factor 10

Transcript Evidence

AK101945

Protein Evidence

Q6I638

Literature

PMID: 22038138

Note

Manual Curation

May 8, 2017

Gene Ontology (GO)

Molecular Function: Rho guanyl-nucleotide exchange factor activity (GO:0005089)

Functional domain (InterPro)

PRONE domain (IPR005512)

Full-length cDNA

J033074L17 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0454200-01)

RiceXPro (AK101945)

Others

Oryzabase (681)

KEGG (Os05t0454200-01)

Transcript

2217 bp

>Os05t0454200-01 Guanine nucleotide exchange factors for Rop, Activation of small cuticular papillae development on leaf epidermis
TGCATATACCACCACCACCTCCCCCGTCCTCCTCTCCTCCACCGCAACCGCAACCACGGC
CAGCCACGGGCCAAGCGAGTCACGACTGGCACAACGAGGCAAAAACACCATTGCTACCCC
CGAGGCGTCCCTCTCAGCTAGCCCTGGCACCCGCACCACCTAGCGGCGGCGCCGTCGTGT
TCGTGTCGGCCAAGTCGTCAAGAAGCTAGCTAGTCATTGCCAGTGGGCGCATTGTGCTAG
GGGATGGCGAGAGGAGGAGGAGGAGGAGAGGAGGCGGCGGAGGAGGAGAGGGAGGTGAGC
GAGGCGCTGACGGCGGACTCGTCGGCCGACGAGGAGTGCCGCCGCGGGAGCAGCAGCTCC
AGCGCAAGCTCCGGGGACGCCTCCAGCGAGTCCTACTGCCCGCCCGACGAGTGGCAGAAG
GTGGCCATCAAGACCTGCGTGTCGTCCGACCTCGTCGTCGTCTCGGCCGAGCCGGCCAAG
GAGAAGAAGCCGCCGCCGCCGCCGTCGTCGCCGCGCGTCGACGCCGCCCCGGCGGACAAG
CACCACCGGCCCTCAGAGATGGAGATGATGAAGGAGAGGTTCGCGAAGCTGCTGCTCGGC
GAGGACATGTCCGGCGGCGGCAAGGGCGTCTGCACCGCGCTCGCCATCTCCAACGCCATC
ACCAACCTCTGCGCGACGATATTTGGGCAGCTGTGGAGGCTGGAGCCGCTGCTGCCGGAG
AAAAAGACGATGTGGCGGCGCGAGATGGACTGGCTGCTCTGCGTCAGCGACCACATCGTC
GAGCTAGTCCCCACATGGCAGACATTCCCCGACGGGAGTAAGCTTGAGATCATGACAAGC
AGGCCACGGTCTGATCTCTACATCAATCTGCCCGCACTCCGAAAGCTAGACCACATGCTC
CTCGAAATTCTGGAGAGCTTCAGGGACCCGGAATTCTGGTACGTCGACCAGGGGATTTGC
CCGCCGGACCGCGACGGCAGCGCCCCCTTCATGCTAACGTTCCACCGCCGCGACGAGAAG
TGGTGGCTGCCCGTGCCCCGCGTCCCTCCCGGCGGCGTCGGCGAGACCACGAGGAGGCAG
CTCGAGCACAAGCGCGACTGCGCCAGCCAGATCCTCAAGGCCGCCATGGCCATCAACAGC
AACGCCCTCGCCGAAATGGACGTCCCCGACTCTTACCTCGACTCGTTACCCAAGAACGGG
CGTGCGACGCTGGGCGACATCATATACAGGTACATCACGTCGGACCAGTTCTCGCCGGAC
TGCCTGCTCGACTGCCTCGACCTGTCGTCGGAGTACCAGGCGCTGGAGATCGCCAACCGC
GTCGAGGCCTCCATCTACGTGTGGCGCCGGAGGGGCACGTCGGGCGCCGCGAGCCGCGCC
GGAAACAAGTCGTCATGGGGCATCGTCAAGGACATGATCATGGACACGGAGAAGAGAGAC
GACCTCCTCGCCGACCGCGCCGAGGGCCTCCTCATGTGCCTCAAGCAGAGGTTCCCCGGA
CTGACGCAGACCAGCCTGGACACGAGCAAGATTCAGTACAACAAGGATGTGGGGAAATCG
ATTCTGGAGAGCTACTCGAGGGTTCTGGAGAGCCTGGCGTCGAACATCATCGCGCGGATC
GACGACCTGCTGTACGTCGACGAGCGGAGCAGGCAGGCGGAGCTGCTTCCAACCGCGGGC
GCCGGGAGCGGCAAGATCTCTTGCATGCCGGCCATGTCGGCGTCGTCGGTGCCGGCGTAC
CCGGTGGTGTCCACCTCGGGCACCCCGCCGCCGTACGCGACGGCGTACGCCACGCCGAGC
TTCTCGCCGGCGCAGCTGTCGAGCCCATCCAACATCGGGAGGGCACTGCTGGTCGACCGG
CGGTCGCACGACGGCCGAGCGTTCGACGGCAGCATGGAGTTCATGGGGATGGCGGTCAGC
AACGCCGTGTTCGACCTACCGGGCCTGTGAATCGATCGATCACGGGCCCCGTGTCTAGTG
CTTTACTTACCCTCGCCTGTGTGCAGTAGTTGTAATGTTGTATGGCGTGATTTCTTCTCG
GGAGGGCGGCCTGTTTTTGCCGTTTCGCCGTTTCGCCGCCCTCCAGTTTTATGATGTGTT
TTGACAGTGCCTTTGTTAACTTGCTAGTGTTGTAAGAGTGCTTAAGTTCGATGTTGGTCG
GATGGCAAAAGAGAACCATCGCGTTTGTGCAAACCACAGAGTTTTCTTGGCTGTTTT

CDS

1707 bp

>Os05t0454200-01 Guanine nucleotide exchange factors for Rop, Activation of small cuticular papillae development on leaf epidermis
ATGGCGAGAGGAGGAGGAGGAGGAGAGGAGGCGGCGGAGGAGGAGAGGGAGGTGAGCGAG
GCGCTGACGGCGGACTCGTCGGCCGACGAGGAGTGCCGCCGCGGGAGCAGCAGCTCCAGC
GCAAGCTCCGGGGACGCCTCCAGCGAGTCCTACTGCCCGCCCGACGAGTGGCAGAAGGTG
GCCATCAAGACCTGCGTGTCGTCCGACCTCGTCGTCGTCTCGGCCGAGCCGGCCAAGGAG
AAGAAGCCGCCGCCGCCGCCGTCGTCGCCGCGCGTCGACGCCGCCCCGGCGGACAAGCAC
CACCGGCCCTCAGAGATGGAGATGATGAAGGAGAGGTTCGCGAAGCTGCTGCTCGGCGAG
GACATGTCCGGCGGCGGCAAGGGCGTCTGCACCGCGCTCGCCATCTCCAACGCCATCACC
AACCTCTGCGCGACGATATTTGGGCAGCTGTGGAGGCTGGAGCCGCTGCTGCCGGAGAAA
AAGACGATGTGGCGGCGCGAGATGGACTGGCTGCTCTGCGTCAGCGACCACATCGTCGAG
CTAGTCCCCACATGGCAGACATTCCCCGACGGGAGTAAGCTTGAGATCATGACAAGCAGG
CCACGGTCTGATCTCTACATCAATCTGCCCGCACTCCGAAAGCTAGACCACATGCTCCTC
GAAATTCTGGAGAGCTTCAGGGACCCGGAATTCTGGTACGTCGACCAGGGGATTTGCCCG
CCGGACCGCGACGGCAGCGCCCCCTTCATGCTAACGTTCCACCGCCGCGACGAGAAGTGG
TGGCTGCCCGTGCCCCGCGTCCCTCCCGGCGGCGTCGGCGAGACCACGAGGAGGCAGCTC
GAGCACAAGCGCGACTGCGCCAGCCAGATCCTCAAGGCCGCCATGGCCATCAACAGCAAC
GCCCTCGCCGAAATGGACGTCCCCGACTCTTACCTCGACTCGTTACCCAAGAACGGGCGT
GCGACGCTGGGCGACATCATATACAGGTACATCACGTCGGACCAGTTCTCGCCGGACTGC
CTGCTCGACTGCCTCGACCTGTCGTCGGAGTACCAGGCGCTGGAGATCGCCAACCGCGTC
GAGGCCTCCATCTACGTGTGGCGCCGGAGGGGCACGTCGGGCGCCGCGAGCCGCGCCGGA
AACAAGTCGTCATGGGGCATCGTCAAGGACATGATCATGGACACGGAGAAGAGAGACGAC
CTCCTCGCCGACCGCGCCGAGGGCCTCCTCATGTGCCTCAAGCAGAGGTTCCCCGGACTG
ACGCAGACCAGCCTGGACACGAGCAAGATTCAGTACAACAAGGATGTGGGGAAATCGATT
CTGGAGAGCTACTCGAGGGTTCTGGAGAGCCTGGCGTCGAACATCATCGCGCGGATCGAC
GACCTGCTGTACGTCGACGAGCGGAGCAGGCAGGCGGAGCTGCTTCCAACCGCGGGCGCC
GGGAGCGGCAAGATCTCTTGCATGCCGGCCATGTCGGCGTCGTCGGTGCCGGCGTACCCG
GTGGTGTCCACCTCGGGCACCCCGCCGCCGTACGCGACGGCGTACGCCACGCCGAGCTTC
TCGCCGGCGCAGCTGTCGAGCCCATCCAACATCGGGAGGGCACTGCTGGTCGACCGGCGG
TCGCACGACGGCCGAGCGTTCGACGGCAGCATGGAGTTCATGGGGATGGCGGTCAGCAAC
GCCGTGTTCGACCTACCGGGCCTGTGA

Protein

569 aa

>Os05t0454200-01 Guanine nucleotide exchange factors for Rop, Activation of small cuticular papillae development on leaf epidermis
MARGGGGGEEAAEEEREVSEALTADSSADEECRRGSSSSSASSGDASSESYCPPDEWQKV
AIKTCVSSDLVVVSAEPAKEKKPPPPPSSPRVDAAPADKHHRPSEMEMMKERFAKLLLGE
DMSGGGKGVCTALAISNAITNLCATIFGQLWRLEPLLPEKKTMWRREMDWLLCVSDHIVE
LVPTWQTFPDGSKLEIMTSRPRSDLYINLPALRKLDHMLLEILESFRDPEFWYVDQGICP
PDRDGSAPFMLTFHRRDEKWWLPVPRVPPGGVGETTRRQLEHKRDCASQILKAAMAINSN
ALAEMDVPDSYLDSLPKNGRATLGDIIYRYITSDQFSPDCLLDCLDLSSEYQALEIANRV
EASIYVWRRRGTSGAASRAGNKSSWGIVKDMIMDTEKRDDLLADRAEGLLMCLKQRFPGL
TQTSLDTSKIQYNKDVGKSILESYSRVLESLASNIIARIDDLLYVDERSRQAELLPTAGA
GSGKISCMPAMSASSVPAYPVVSTSGTPPPYATAYATPSFSPAQLSSPSNIGRALLVDRR
SHDGRAFDGSMEFMGMAVSNAVFDLPGL*

5'UTR

chr05:22293498..22293740 (+ strand) : 243 bp

CDS

chr05:22293741..22294053 (+ strand) : 313 bp

chr05:22294134..22294250 (+ strand) : 117 bp

chr05:22294342..22294496 (+ strand) : 155 bp

chr05:22295133..22295207 (+ strand) : 75 bp

chr05:22295325..22295615 (+ strand) : 291 bp

chr05:22296088..22296438 (+ strand) : 351 bp

chr05:22296536..22296940 (+ strand) : 405 bp

3'UTR

chr05:22296941..22297207 (+ strand) : 267 bp

FASTA

>Os05t0454200-01 class=Sequence position=chr05:22293498..22297207 (+ strand)
TGCATATACC ACCACCACCT CCCCCGTCCT CCTCTCCTCC ACCGCAACCG CAACCACGGC CAGCCACGGG CCAAGCGAGT
CACGACTGGC ACAACGAGGC AAAAACACCA TTGCTACCCC CGAGGCGTCC CTCTCAGCTA GCCCTGGCAC CCGCACCACC
TAGCGGCGGC GCCGTCGTGT TCGTGTCGGC CAAGTCGTCA AGAAGCTAGC TAGTCATTGC CAGTGGGCGC ATTGTGCTAG
GGGATGGCGA GAGGAGGAGG AGGAGGAGAG GAGGCGGCGG AGGAGGAGAG GGAGGTGAGC GAGGCGCTGA CGGCGGACTC
GTCGGCCGAC GAGGAGTGCC GCCGCGGGAG CAGCAGCTCC AGCGCAAGCT CCGGGGACGC CTCCAGCGAG TCCTACTGCC
CGCCCGACGA GTGGCAGAAG GTGGCCATCA AGACCTGCGT GTCGTCCGAC CTCGTCGTCG TCTCGGCCGA GCCGGCCAAG
GAGAAGAAGC CGCCGCCGCC GCCGTCGTCG CCGCGCGTCG ACGCCGCCCC GGCGGACAAG CACCACCGGC CCTCAGGTAC
GTGCGCCGCC GCCGCAAATC CCCAGTTCAC TCCTCCCTTC CAACACACGC GGTTAAATTA ATTGAATTGG CTGCAGAGAT
GGAGATGATG AAGGAGAGGT TCGCGAAGCT GCTGCTCGGC GAGGACATGT CCGGCGGCGG CAAGGGCGTC TGCACCGCGC
TCGCCATCTC CAACGCCATC ACCAACCTCT GCGGTAAGTG GGAGGTTTCG AATTGCACAT TGCGATTAAT GCGGCGGTTT
CATGGACACG GACATGGAGG CTGAGCTGAG TTGCGTTGCT GCAGCGACGA TATTTGGGCA GCTGTGGAGG CTGGAGCCGC
TGCTGCCGGA GAAAAAGACG ATGTGGCGGC GCGAGATGGA CTGGCTGCTC TGCGTCAGCG ACCACATCGT CGAGCTAGTC
CCCACATGGC AGACATTCCC CGACGGGAGT AAGCTTGAGG TATACTAGTA CTTCACTTCC CCTGACGAAA TTTACTCTGC
ACTTCTGCAG TAGTTAAGCT AGGAGTGATA CAGGAATTAC TAGGATCATC AGTGCGGGCC GTTCGTGAGC ACTGAGTAGC
AGATGCAAGA TTTAATTTGG CGTCCTACGG ATGAACCATG AAGCGAGTGC AAAATTCGAT TTGAATTTTA CATGAACATA
TGGACCACAA AAAGAAATTA TATATAGTCA TTAAATACGT GGTTAGCCGT TTGGTACTTA GTAATCCCGT TTATATTGAA
ACAGTTGGGC GCGCGACGCC GTATTTCTGA GGCCCAAAAG AGTTAAGGCC ACATCAATGT GCTGTCCGTT TAGTTGTGTC
CGATTTGTTT GTCCTCAAAT TATCCGGTCC AAACGTGATC CATTACTACT CTAGATCAAA TGGAGATCCA TCATTTCCCA
CTTGCTGCAT CTGTTTACAC CAATCTTTCT TCTGTAGTGT CCAACTTTAT TCGACAATGC AATGTTCAGG TCTTTTTTTG
GCAAGGAAAT GTTCAGTTTC TTTTTTTTAT GAACTCTTAC ACAGACACAT TATATAACTT GTGGTGAGAA CAATGATAAA
CTGACTGTTA CTCTACATGT GGATTACTAC TTCAGATCAT GACAAGCAGG CCACGGTCTG ATCTCTACAT CAATCTGCCC
GCACTCCGAA AGCTAGACCA CATGCTCCTC GTAAGTCTGA CGAACTCTAT CTCGGATCAA CGATCTGTCC ATCCATCCGA
AAATAAAAGA TGAACTAGTG CTGTAATAAT GTGCATCTCC TGACGAAACG AGCACATCTT CTGCCAGGAA ATTCTGGAGA
GCTTCAGGGA CCCGGAATTC TGGTACGTCG ACCAGGGGAT TTGCCCGCCG GACCGCGACG GCAGCGCCCC CTTCATGCTA
ACGTTCCACC GCCGCGACGA GAAGTGGTGG CTGCCCGTGC CCCGCGTCCC TCCCGGCGGC GTCGGCGAGA CCACGAGGAG
GCAGCTCGAG CACAAGCGCG ACTGCGCCAG CCAGATCCTC AAGGCCGCCA TGGCCATCAA CAGCAACGCC CTCGCCGAAA
TGGACGTCCC CGACTCTTAC CTCGACTCGT TACCCAAGGT CCAAATCAAT TCTACTACCT GTAGAGAATA GGAGACGGAT
TCTAATCAAC CGcaactaaa tggttatgaa ttttttttaa aaaaataaca agatagatta atatgtaata tattactcca
caaacataca atttcgaatt taacttttac aagttataaa aaataacaaa tttaattgca aatatacgta tactaattta
agttttattt gttgtttttg ttacaatttt tagaagttga aatttaactt acatgtttgt ggagtgatat attacatatt
gttctatctt tttaattatt tttaaaaaag ttttataatt atttagatga catgcaTTCA CTTGGGTGAT TAAAAGAGTT
TTCCGTAGAG AATACTGTAA AAATTATCAG AAAAAAGAAA ACTACACTAA TGCTCATCAT ACATGAACGT TTGCTGTTTC
TTGATTCTGA CATTGATGTT TGATTGTCAG AACGGGCGTG CGACGCTGGG CGACATCATA TACAGGTACA TCACGTCGGA
CCAGTTCTCG CCGGACTGCC TGCTCGACTG CCTCGACCTG TCGTCGGAGT ACCAGGCGCT GGAGATCGCC AACCGCGTCG
AGGCCTCCAT CTACGTGTGG CGCCGGAGGG GCACGTCGGG CGCCGCGAGC CGCGCCGGAA ACAAGTCGTC ATGGGGCATC
GTCAAGGACA TGATCATGGA CACGGAGAAG AGAGACGACC TCCTCGCCGA CCGCGCCGAG GGCCTCCTCA TGTGCCTCAA
GCAGAGGTTC CCCGGACTGA CGCAGACCAG CCTGGACACG AGCAAGATTC AGTACAACAA GGTTGGTGAA TCCATCATTT
GCAGTTTGCA AATCTCGCTA TCCGTGTTGA TGGTGATCGG GTTTGGATGA ACTGATCGTG AGATGACTCT CTCTTCAGGA
TGTGGGGAAA TCGATTCTGG AGAGCTACTC GAGGGTTCTG GAGAGCCTGG CGTCGAACAT CATCGCGCGG ATCGACGACC
TGCTGTACGT CGACGAGCGG AGCAGGCAGG CGGAGCTGCT TCCAACCGCG GGCGCCGGGA GCGGCAAGAT CTCTTGCATG
CCGGCCATGT CGGCGTCGTC GGTGCCGGCG TACCCGGTGG TGTCCACCTC GGGCACCCCG CCGCCGTACG CGACGGCGTA
CGCCACGCCG AGCTTCTCGC CGGCGCAGCT GTCGAGCCCA TCCAACATCG GGAGGGCACT GCTGGTCGAC CGGCGGTCGC
ACGACGGCCG AGCGTTCGAC GGCAGCATGG AGTTCATGGG GATGGCGGTC AGCAACGCCG TGTTCGACCT ACCGGGCCTG
TGAATCGATC GATCACGGGC CCCGTGTCTA GTGCTTTACT TACCCTCGCC TGTGTGCAGT AGTTGTAATG TTGTATGGCG
TGATTTCTTC TCGGGAGGGC GGCCTGTTTT TGCCGTTTCG CCGTTTCGCC GCCCTCCAGT TTTATGATGT GTTTTGACAG
TGCCTTTGTT AACTTGCTAG TGTTGTAAGA GTGCTTAAGT TCGATGTTGG TCGGATGGCA AAAGAGAACC ATCGCGTTTG
TGCAAACCAC AGAGTTTTCT TGGCTGTTTT