Os05t0457200-01

Locus

Os05g0457200

Description

Similar to protein phosphatase 2C.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPP2C49, PP2C49, OsPP76

Oryzabase Gene Name Synonym(s)

protein phosphatase 2C49, protein phosphatase 2C 49, protein phosphatase 76

Transcript Evidence

AK242098 (DDBJ, Best hit)

Protein Evidence

NP_001149037.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein dephosphorylation (GO:0006470)

Cellular Component: protein serine/threonine phosphatase complex (GO:0008287)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein serine/threonine phosphatase activity (GO:0004722)

Functional domain (InterPro)

Protein phosphatase 2C, manganese/magnesium aspartate binding site (IPR000222)

Protein phosphatase 2C-like (IPR001932)

Protein phosphatase 2C (IPR015655)

Full-length cDNA

J075143H11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0457200-01)

Others

Oryzabase (17878)

KEGG (Os05t0457200-01)

Transcript

1697 bp

>Os05t0457200-01 Similar to protein phosphatase 2C.
GTCTGCTGCCACCTCGCGCTCGCGCTCTCTGCTCCGTCGCGATTCGCCACCTCGCCCTCG
TCTCGTTTTAGCGCCCCCCCGAGGGCGACGGCGACGGCGACGACGACGGCGACGCGCGGT
GTTGCGACGAAATATCTATCGTGCGTGGGCTAGCGGCGGTGGCGTGACGTACGCGGGAGG
AGAAGGGGGGAGGCGCTCGTGCTCGTGCGCGCGGCCGGCACGACGCCCCATGGCCGCCGA
GATCTGCCGCGAGGAGGCGGCCAAGTCGATGCCGGCTGCGGCGGCCGGCGCCACGGCGAT
CGCCAGGCGGCGCCGTAGGGTGGAGGGCTTCCGCTTTGCGGCCGGCTCTCTCGAGCCGCC
GCAGGAGGATGCTGACGCCGGTGTGGCGCGCTGCGGCAAGCGGCAGAGGGTGGCGGGCGC
GCGTGCGGGCGCAGGCGCGGCGACCGCAGGCCCGTGCCGTCCGTCGGCCGGCGCGGAGTT
CGGGTCCAGGTGGTGGCCGAGGTACGGCGTCACCTCCGTGTTCGGCCGGCGGCGCGAGAT
GGAGGACGCCGTGTCCATCAGGCCGGACTTCCTGCGGGGCTCCACCTCTTCCGGCAAGCA
CCACTTCTTCGGCGTCTTTGACGGCCATGGTTGCTCCCATGTATGCATGCGCGCACGCAA
GAAACAGATTGCACACATGAGCCTATGACCAAATCCAGCAAATGCACGTCGAGCTGTGTT
GCTAAGCGGAGCCCGTTCTTTAATTTGTGGCGTCAGGTCGCGAGGATGTGCCAGGACCGG
ATGCATGAGCTCGTCGTCGACGCGTACAAGAAGGCGGTCTCCGGCAAGGAGGCGGCGGCG
GCGGCACCGGCGTGGAAGGACGTCATGGAGAAAGGGTTCGCGCGGATGGACGATGAGGCG
ACGATCTGGGCCAAGAGCCGCACCGGCGGTGAGCCGGCCTGCCGCTGCGAGCTGCAGACG
CCAGCACGGTGCGACCACGTGGGCTCGACCGCCGTTGTCGCGGTCGTCGGTCCTAACCGC
GTCGTCGTCGCCAACTCCGGCGACTCCCGTGCCGTCCTCTGCCGCGCCGGCGTCCCCGTC
CCCCTCTCCGTCGACCACAAGCCGGACCGGCCGGACGAGCTGGAGCGCATCAAGGCGGCG
GGCGGCCGCGTCATCTACTGGGACGGCGCCAGGGTGCTCGGCGTCCTCGCCATGTCTCGA
GCCATCGgggacggctacctgaagccgtacgtgacgtcggagccggaggtgacggtgacg
gagcgcgccgacgacgatgagtgcctgatcctggcgagcgacgggctgtgggacgtggtg
accaacgagatggcgtgcgaggtcgtccgggcgtgcttccggagcaacggcccgccgtcg
ccgccgggatgctcccgccccaaagccgtgctcccgccgcccgccggcgcgtcaggcggc
ggcggcggcgacgccgtggtgaagggggtcgacaaggccGAGTCCGACAAGGCGTGCGCC
GACGCGGCATTGCTTCTCGCGAAGCTCGCGATCGCCCGGCGGAGCGCCGACAACGTGAGC
GTCGTCGTCGTGGATCTCCGCCGGCCGGTGCCGTGATCCGCCATTATTATTGGCTTATTC
TCTTCCTCCTCTATTTTTTTTCACTTCTTCCCTCCTAATTTACTCCTGCGATCATCGTCG
CAAAGAATTTACTTAGT

CDS

459 bp

>Os05t0457200-01 Similar to protein phosphatase 2C.
ATGGCCGCCGAGATCTGCCGCGAGGAGGCGGCCAAGTCGATGCCGGCTGCGGCGGCCGGC
GCCACGGCGATCGCCAGGCGGCGCCGTAGGGTGGAGGGCTTCCGCTTTGCGGCCGGCTCT
CTCGAGCCGCCGCAGGAGGATGCTGACGCCGGTGTGGCGCGCTGCGGCAAGCGGCAGAGG
GTGGCGGGCGCGCGTGCGGGCGCAGGCGCGGCGACCGCAGGCCCGTGCCGTCCGTCGGCC
GGCGCGGAGTTCGGGTCCAGGTGGTGGCCGAGGTACGGCGTCACCTCCGTGTTCGGCCGG
CGGCGCGAGATGGAGGACGCCGTGTCCATCAGGCCGGACTTCCTGCGGGGCTCCACCTCT
TCCGGCAAGCACCACTTCTTCGGCGTCTTTGACGGCCATGGTTGCTCCCATGTATGCATG
CGCGCACGCAAGAAACAGATTGCACACATGAGCCTATGA

Protein

153 aa

>Os05t0457200-01 Similar to protein phosphatase 2C.
MAAEICREEAAKSMPAAAAGATAIARRRRRVEGFRFAAGSLEPPQEDADAGVARCGKRQR
VAGARAGAGAATAGPCRPSAGAEFGSRWWPRYGVTSVFGRRREMEDAVSIRPDFLRGSTS
SGKHHFFGVFDGHGCSHVCMRARKKQIAHMSL*

5'UTR

chr05:22452403..22452631 (- strand) : 229 bp

CDS

chr05:22451944..22452402 (- strand) : 459 bp

3'UTR

chr05:22451531..22451943 (- strand) : 413 bp

chr05:22451351..22451456 (- strand) : 106 bp

chr05:22450771..22451260 (- strand) : 490 bp

FASTA

>Os05t0457200-01 class=Sequence position=chr05:22450771..22452631 (- strand)
GTCTGCTGCC ACCTCGCGCT CGCGCTCTCT GCTCCGTCGC GATTCGCCAC CTCGCCCTCG TCTCGTTTTA GCGCCCCCCC
GAGGGCGACG GCGACGGCGA CGACGACGGC GACGCGCGGT GTTGCGACGA AATATCTATC GTGCGTGGGC TAGCGGCGGT
GGCGTGACGT ACGCGGGAGG AGAAGGGGGG AGGCGCTCGT GCTCGTGCGC GCGGCCGGCA CGACGCCCCA TGGCCGCCGA
GATCTGCCGC GAGGAGGCGG CCAAGTCGAT GCCGGCTGCG GCGGCCGGCG CCACGGCGAT CGCCAGGCGG CGCCGTAGGG
TGGAGGGCTT CCGCTTTGCG GCCGGCTCTC TCGAGCCGCC GCAGGAGGAT GCTGACGCCG GTGTGGCGCG CTGCGGCAAG
CGGCAGAGGG TGGCGGGCGC GCGTGCGGGC GCAGGCGCGG CGACCGCAGG CCCGTGCCGT CCGTCGGCCG GCGCGGAGTT
CGGGTCCAGG TGGTGGCCGA GGTACGGCGT CACCTCCGTG TTCGGCCGGC GGCGCGAGAT GGAGGACGCC GTGTCCATCA
GGCCGGACTT CCTGCGGGGC TCCACCTCTT CCGGCAAGCA CCACTTCTTC GGCGTCTTTG ACGGCCATGG TTGCTCCCAT
GTATGCATGC GCGCACGCAA GAAACAGATT GCACACATGA GCCTATGACC AAATCCAGCA AATGCACGTC GAGCTGTGTT
GCTAAGCGGA GCCCGTTCTT TAATTTGTGG CGTCAGGTCG CGAGGATGTG CCAGGACCGG ATGCATGAGC TCGTCGTCGA
CGCGTACAAG AAGGCGGTCT CCGGCAAGGA GGCGGCGGCG GCGGCACCGG CGTGGAAGGA CGTCATGGAG AAAGGGTTCG
CGCGGATGGA CGATGAGGCG ACGATCTGGG CCAAGAGCCG CACCGGCGGT GAGCCGGCCT GCCGCTGCGA GCTGCAGACG
CCAGCACGGT GCGACCACGT GGGCTCGACC GCCGTTGTCG CGGTCGTCGG TCCTAACCGC GTCGTCGTCG CCAACTCCGG
CGACTCCCGT GCCGTCCTCT GCCGCGCCGG CGTCCCCGTC CCCCTCTCCG TCGACCACAA GGTAAGCAGC AAAGCACTAA
TCCAACGTCG TCTTCCTCGC TTGCTTCTGC GTATTCACCT CTCTGTTTGC TCCAGCCGGA CCGGCCGGAC GAGCTGGAGC
GCATCAAGGC GGCGGGCGGC CGCGTCATCT ACTGGGACGG CGCCAGGGTG CTCGGCGTCC TCGCCATGTC TCGAGCCATC
GGTACGCGCT GCGTTCGCGC TTAGATCATT TTAAGTTTGG AGCAATTTGG CCGTGGTGCT TGACGCGGTG GCCGGCGGCG
CGCGCAtgca ggggacggct acctgaagcc gtacgtgacg tcggagccgg aggtgacggt gacggagcgc gccgacgacg
atgagtgcct gatcctggcg agcgacgggc tgtgggacgt ggtgaccaac gagatggcgt gcgaggtcgt ccgggcgtgc
ttccggagca acggcccgcc gtcgccgccg ggatgctccc gccccaaagc cgtgctcccg ccgcccgccg gcgcgtcagg
cggcggcggc ggcgacgccg tggtgaaggg ggtcgacaag gccGAGTCCG ACAAGGCGTG CGCCGACGCG GCATTGCTTC
TCGCGAAGCT CGCGATCGCC CGGCGGAGCG CCGACAACGT GAGCGTCGTC GTCGTGGATC TCCGCCGGCC GGTGCCGTGA
TCCGCCATTA TTATTGGCTT ATTCTCTTCC TCCTCTATTT TTTTTCACTT CTTCCCTCCT AATTTACTCC TGCGATCATC
GTCGCAAAGA ATTTACTTAG T