Os05t0463800-01

Locus

Os05g0463800

Description

Similar to Nuclear transcription factor Y subunit B-3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HAP3C

CGSNL Gene Name

HAP3C SUBUNIT OF CCAAT-BOX BINDING COMPLEX

Oryzabase Gene Symbol Synonym(s)

OsHAP3C, OsNF-YB-4, NFYB4, OsNF-YB3, NF-YB3, NFYB3, OsHAP3B, HAP3B

Oryzabase Gene Name Synonym(s)

rice HAP3C, Nuclear transcription factor Y subunit B-4, Transcriptional activator HAP3C, NUCLEAR FACTOR-Y subunit B3, NUCLEAR FACTOR-Y subunit NF-YB3, NF-YB subunit 3, NF-YB family 3

Transcript Evidence

AK100811 (DDBJ, Best hit)

Protein Evidence

Q60EQ4 (UniProt)

Literature

Note

  • CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Cellular Component: intracellular (GO:0005622)

Cellular Component: nucleus (GO:0005634)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

Transcription factor, NFYB/HAP3, conserved site (IPR003956)

Transcription factor, CBFA/NFYB, DNA topoisomerase (IPR003957)

Transcription factor CBF/NF-Y/archaeal histone (IPR003958)

Histone-fold (IPR009072)

Full-length cDNA

J023121O11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0463800-01)

Others

Oryzabase (3125)

Transcript

1222 bp

>Os05t0463800-01 Similar to Nuclear transcription factor Y subunit B-3.
ACCCCGACCCCTTCAATCGCGCCCGCCTCAGCCGCCTTCTCTTCTCCAGCGTCCGATCTC
CCCCTCTCGCCTCTCCGCCTCACCTCCGCTCCGCTTCCCACCCCCGCTTCCTCTCTCTCT
CCTCTCCCCCTCTCTCTCTCTCTCTCTCCTCCTCGCTTCACCACCTCGCGCCCAACCCCC
CTCTCTCTCCTCTCCACGTCGCGCCCTCTCCGCGCGCGCCCGCGCTTCTATATAAGGAGG
GGGGAGGTGGGATGGCGGATGGGCCGGGGAGCCCGGGGGGAGGAGGGGGGAGCCACGAGA
GCGGGAGCCCGAGGGGGGGAGGGGGAGGAGGGGGAGGTGGGGGTGGGGGTGGGGGGGTGA
GGGAGCAGGACAGGTTCCTCCCCATCGCCAACATCAGCCGCATCATGAAGAAGGCCATCC
CGGCCAACGGGAAGATCGCCAAGGACGCCAAGGAGACCGTGCAGGAGTGCGTCTCCGAGT
TCATCTCCTTCATCACCAGCGAGGCGAGCGATAAATGCCAGAGGGAGAAGCGCAAGACCA
TCAACGGCGACGACTTGCTGTGGGCGATGGCCACGCTGGGCTTCGAGGACTACATCGAGC
CCCTCAAGGTCTACCTGCAGAAGTACAGAGAGGTGCGGTGATAGTAAATTAACTGCAAAG
GCTGGTGATGGCTCTGTGAAAAAGGATGTACTTGGTTCTCATGGAGGAAGCAGTTCAAGT
GCCCAAGGGATGGGCCAACAAGCAGCATACAATCAAGGAATGGGTTATATGCAACCTCAG
TACCATAATGGGGATGTCTCAAACTGAAGATAGGACCTTTTCATGCAACTGTTGCTAGCG
CAGGTGGATTTTATTTGGTGCTGCAGTCGTTAGCTAATATATATACCTACACCTCATGGT
GAGCAGTGAAGGAAGTAACTTGCTACCACCTCTAGGTCCCATGTTTGTCAACCAGGAACT
GATGCTGCTTGGAAGCGTCGAGCCAAGGCTGCTTCTCAGATGTAAATTACTCCCCGTGAG
GATAGTTTCGGTTCGTGGTCTAGCTCTGTTGTTGTATGTATATTCAGGATAATTTAACAA
TTGGTCTTTGGCTGTCATTCGGTTCCATATAATCTGTATTGGGAGGCATAAATATTCATG
TTGTATTTCGTCCTGAACTAGCGTGTTGTACTATTGAGAAATAGATGCTCTCTGTAATGG
TAGCAATTTTACTCTGATTCCC

CDS

390 bp

>Os05t0463800-01 Similar to Nuclear transcription factor Y subunit B-3.
ATGGCGGATGGGCCGGGGAGCCCGGGGGGAGGAGGGGGGAGCCACGAGAGCGGGAGCCCG
AGGGGGGGAGGGGGAGGAGGGGGAGGTGGGGGTGGGGGTGGGGGGGTGAGGGAGCAGGAC
AGGTTCCTCCCCATCGCCAACATCAGCCGCATCATGAAGAAGGCCATCCCGGCCAACGGG
AAGATCGCCAAGGACGCCAAGGAGACCGTGCAGGAGTGCGTCTCCGAGTTCATCTCCTTC
ATCACCAGCGAGGCGAGCGATAAATGCCAGAGGGAGAAGCGCAAGACCATCAACGGCGAC
GACTTGCTGTGGGCGATGGCCACGCTGGGCTTCGAGGACTACATCGAGCCCCTCAAGGTC
TACCTGCAGAAGTACAGAGAGGTGCGGTGA

Protein

130 aa

>Os05t0463800-01 Similar to Nuclear transcription factor Y subunit B-3.
MADGPGSPGGGGGSHESGSPRGGGGGGGGGGGGGGVREQDRFLPIANISRIMKKAIPANG
KIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIEPLKV
YLQKYREVR*

5'UTR

chr05:22773847..22774082 (- strand) : 236 bp

chr05:22773729..22773743 (- strand) : 15 bp

CDS

chr05:22773478..22773728 (- strand) : 251 bp

chr05:22773192..22773325 (- strand) : 134 bp

chr05:22771749..22771753 (- strand) : 5 bp

3'UTR

chr05:22771661..22771748 (- strand) : 88 bp

chr05:22771536..22771586 (- strand) : 51 bp

chr05:22770569..22770626 (- strand) : 58 bp

chr05:22770094..22770477 (- strand) : 384 bp

FASTA

>Os05t0463800-01 class=Sequence position=chr05:22770094..22774082 (- strand)
ACCCCGACCC CTTCAATCGC GCCCGCCTCA GCCGCCTTCT CTTCTCCAGC GTCCGATCTC CCCCTCTCGC CTCTCCGCCT
CACCTCCGCT CCGCTTCCCA CCCCCGCTTC CTCTCTCTCT CCTCTCCCCC TCTCTCTCTC TCTCTCTCCT CCTCGCTTCA
CCACCTCGCG CCCAACCCCC CTCTCTCTCC TCTCCACGTC GCGCCCTCTC CGCGCGCGCC CGCGCTTCTA TATAAGGTAC
GCCTACGCCT CTCTCTCCTT CGCTCGAATC CCATTTCTAG GGTTTTGGGA TGCGGGGACT GATGGATCTA GGGTTTGGGT
TTGGGTGGTG GTGGTGCAGG AGGGGGGAGG TGGGATGGCG GATGGGCCGG GGAGCCCGGG GGGAGGAGGG GGGAGCCACG
AGAGCGGGAG CCCGAGGGGG GGAGGGGGAG GAGGGGGAGG TGGGGGTGGG GGTGGGGGGG TGAGGGAGCA GGACAGGTTC
CTCCCCATCG CCAACATCAG CCGCATCATG AAGAAGGCCA TCCCGGCCAA CGGGAAGATC GCCAAGGACG CCAAGGAGAC
CGTGCAGGAG TGCGTCTCCG AGTTCATCTC CTTCATCACC AGCGAGTGAG TCGTCGCCCT CGTCCTCCCC CCTCTTGTGC
TCTGCTCTGC TCTGCTCTGT CTTCTTTTGA GTTTTGAGCT TTGAGCTCGT TGTTTGACTT GTCGTTGGCG GCGATGAGAT
GTGACTGGGT TTTTGTTGTG GTGGGGCAAC ATTACAGGGC GAGCGATAAA TGCCAGAGGG AGAAGCGCAA GACCATCAAC
GGCGACGACT TGCTGTGGGC GATGGCCACG CTGGGCTTCG AGGACTACAT CGAGCCCCTC AAGGTCTACC TGCAGAAGTA
CAGAGAGGTG CGTACTGATG TGGATGTTTG GAATTGGGGT GATTCTCTGT TGATTTAAAA AGGTTTAGTT ATTGCTTTGC
GAGTTAGGTA GGGACATCGC TAGTTTGCTT TTTCGAGGTG TGTCTGAATT ACTAATAACT TGCTTGGTAA CCTTAATATT
ATTAGGGAGT ATACTCTAGT AATTTGTTCA ACTTGAGGAC GGATGGATAA CTTGTAATGT TTGTGGTATG AGCTAATTTC
TTTAGCTCAT GTTGCTTTGG AAGAAAGATT CTTGTCAGCA AATCTTGCTT TATGATTCCA ATTTTATACC GTGAAAGGAA
TGGTTGGAAT ATGGTGTTAG TACATTAATT AATTAATTGA AAGCTGTTGC TTGGACCTGA AAACACAGCA GTGATCATTT
GCAGTAACCT ACTAACCTTG TACCAAGTCC AAATTTTTAT GAATCGTTGA GCTACTAAAA TGCTATTTAA TTCATTTACC
ATGTTTACCG TCAATCTTAA ATTTTATAAG ATCCAATGCA AATACAGTAA AATGTTTTGA ATCAACCAGA GATCCTATAA
AAAGATCACC TTTACACTGA AAGTTTACTT ACCTGAAGAT AAAACTTCCT ACTTACACGA CATATCATAG TGTAGCTTTA
AAAAAAGACC AAATTCTCTA CAACATTTTT TTTAGTGTAG CCTGGAGTTA AAACATTAAT ACTTTGTGTA TGCCTGTCAT
TTTCGTTTGT TAAGTCTCCT TTATCAATCT AATATGGCTT CTCTTGTTTG TTTTTGTTTG GTGAATGGCT GTGCTGGTTG
CAGATGGAGG TACGTGGTAT TTAACTATTT TGTTATCATG TTCCATAGGC TACTGATTTT TTTGCTTGAT GATGAGTGCC
TCCTACAAAT CCATGCTTTT CTTTGTGTTC ATATTTCATA GACACTAAGA GGCATTCATA TTTCATAGAC ACTAAGATGC
AAATGTTCAA GATATATAAA GTTCATAAAT AAAATCAGCC TTGAAAATGA ATTATTGATC TATACAATCC TGTCTGCATC
ATGAGCTTAG CTCACCTGTG CAGCTAGCTA TGTCCAAATT TTGAAGGCAT ATAGAATTCT CTTCATGGGA TCCAATAATT
CCATCAGTTT TAGATCGTAT ATATACCTTG TTCTTGTCAA TTGGATGTAC TATGATGCTT CGTATAGTCT TGAGTGAAAC
AAATTTTTTA TCAAGTTTCC CTGTATCAAT TCTATATGGG CCAAAAAATT GCATGCTACA TGCCTTTGAA AATCAATAGG
TAAAAAGACA AGATGAATCA TGATTCTGCA CCATACAGCA AGCAGAGCAC TCTTTTACTA TGGTTAAGAC CAAGAATTCT
ATTATGATTC ATGATTGTAC TATCATGCCT ACACAAAATC TGAGATGTGT TGAGTATTGC TCAGCTCTTT TATCATCATT
AAAACATAGG GTGATAGTAA ATTAACTGCA AAGGCTGGTG ATGGCTCTGT GAAAAAGGAT GTACTTGGTT CTCATGGAGG
AAGCAGTTCA AGTGCCCAAG GGGTTAGTGT CTGCTTGTTT GTTTTCTTGT TCCTGTCCAA CAGGATGTGA ACTTACACTA
TTTTTATTCT TTATAGATGG GCCAACAAGC AGCATACAAT CAAGGAATGG GTTATATGCA ACCTCAGGTG ATTTATCTTC
AATTGTTTGG AATTACTGGC AGTATGCATA TACACATGGT TGATCGTTGT CAAAGTATTT TGCTGAATAT ACCGTCATGT
CTTGGGAGCA TACAAGACAA TATTGTGGTT TAGACTTCGG GGAGTTCCAT TAGCTAGTTG ATTCACAGTT GTGTTTGATT
TTTTTCCTCT TTGTTTTAGG ATATTTTTAC TGGCCATGTA GTACGTTTAG TTTAGATTTA TCAGCTTTAT TATGCCTATA
TTTGTTCTAA TAATAACATG AACGTGAGAT TCTCTGGTAA ATATCTAGTA GTGCCATCCT GCTACCATTC TACTGCCACT
GGTCATTTTA AAGAGACACA TGAGAAGATA ACTTTTAATC TCCTTATTGT GCCGTCCTTT TGTTTCTTCA GTGTTAGGAG
ACTTCTACTG TTTGGAAGTT CCTGGAGTAG TAAACATGAT TGGCCTCTCC ATCCTCTACT TCCCCTGTAC CAAAAAAAAT
CAATTCCTTG CAATGAATCT AGACAAATGT TTGTCCAGAT TCAAAGCAAG TTGTTTTTTT TGGTACAGAG AGTATGTTGT
TGGACTGTCC CTTTTAGGTT GATTCATTGT CTAGTTACTG AGATCAAAGA ATTACTGGAT ATTTTGTGTA TGAACAGTAA
ATGAATGATA AATCCATAAA TCTAGGTGCA TTTCCTTCAG CAGAATGCAT CCAGCCAGAG CTTGTTTCCC TTCCTTTTTT
TGTTTTGGTT AGATCTGGGC AAAATCCATT AAAAAAACTG AAACATGCAC AAAGTTACTG TTTGAGTGTA AGAGTTCACT
TTTCAATATT TCTGGCATAA GATATTGCCA CTTGCATAAT CTCATCTGAT CTCGATACGT TTGCTGATGT TTTTTTCTTT
CTTTTGCCTT GCCCAGTACC ATAATGGGGA TGTCTCAAAC TGAAGATAGG ACCTTTTCAT GCAACTGTTG CTAGGTATAC
CTAATCCGTC GAAGAACCAT ATGCTATTTC GAATTTTTGA TATCTTGTAC GGGAATGGTT CATGTGCCGA CACATTTGCT
AATAGCGCAG GTGGATTTTA TTTGGTGCTG CAGTCGTTAG CTAATATATA TACCTACACC TCATGGTGAG CAGTGAAGGA
AGTAACTTGC TACCACCTCT AGGTCCCATG TTTGTCAACC AGGAACTGAT GCTGCTTGGA AGCGTCGAGC CAAGGCTGCT
TCTCAGATGT AAATTACTCC CCGTGAGGAT AGTTTCGGTT CGTGGTCTAG CTCTGTTGTT GTATGTATAT TCAGGATAAT
TTAACAATTG GTCTTTGGCT GTCATTCGGT TCCATATAAT CTGTATTGGG AGGCATAAAT ATTCATGTTG TATTTCGTCC
TGAACTAGCG TGTTGTACTA TTGAGAAATA GATGCTCTCT GTAATGGTAG CAATTTTACT CTGATTCCC