Os05t0464100-01

Locus

Os05g0464100

Description

MCM family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM8

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsMCM8

Oryzabase Gene Name Synonym(s)

mini-chromosome maintenance protein 8

Transcript Evidence

AK108033 (DDBJ, Best hit)

Protein Evidence

NP_187577.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

002-137-B12 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0464100-01)

RiceXPro (AK108033)

Others

Oryzabase (7361)

KEGG (Os05t0464100-01)

Transcript

1734 bp

>Os05t0464100-01 MCM family protein.
GAGCTTCACGCCGTCCTCGCTCGCCGCGCTAAAAATTTCGCTCCGCCCGCCCCCCAACTC
TCCTCTCCCGCCGCCGCCGCCGCTGCCGCGCAACTCGCCGGAGAGAGAAGGGAGCGGCCC
ATTTCTCAGGCGAACATGTACGACGATGGTCCTCGCAAGGGAAAACCCGGCGgcctctcc
atggacgccgccaccgccgcggggctcgcggcggtctggccggagtacttcccggaggag
agcgagttcgccgcggacggccgcagcgcgcgcctCGCCGCCGACCTGGTCGACCTCTTC
TCCTCCCCCGACGCGAGCGACCTCCTCTCGCGAGTCGAAGATGATGGTGATATCCTCTCC
CTTCCAGTTGATTTCCAGCAGCTATCGAATTTGACCTGGATTACTGAAGCTCTCCAGGAA
AATCCAAAAGAAGCCTTGCTTTCCATGGGAGCTGCAGTTCATCTGATTGTGTGTGCTAGC
AGGGACTTGCAGTTGGGCGACATCAACAAAATCAATATCAGGCTTTACAACCACACCAAG
ACTATTGCCTTGAAGAATTTAAAAGCGGCGTATATTAAGAAACTTGTGACAGTGCGTGGA
ACAGTCTTAAAAGTAAGTACGGTGAAGCCTCTAGTGCTGCAGCTGAATTTCCAATGCATG
AAATGCGCTACAAAATTCCCTCGTGTGTTCTGTGATGGGAAGTTTTCACCTCCAGTATCG
TGCAGTATTCAGGGATGCAAGAGCAGAACATTCATACCAATGAGATCTACTGCAAAGTTG
ATGGATTTTCAGAAAATAAGGATACAAGAGCTTGCTAGTGGTGAAAGCCATGAAGAAGGC
AGAGTGCCACGAACTATAGAGTGTGAGCTTACAGAGGATCTTGTAGATTGTTGCATCCCT
GGAGAGACTGTAACAGTTACTGGAATCGTCAAAGTACTGAACAACTACATGGATGTTGGA
GGAGGGAAATCCAAAAGCAGGAACCAAGGTTTATACTACCTGTACCTGGAAGCAATTTCA
GTAAGAAACTCAAAGGTCCATGCTGCTTCAGGAAATTCAGATGCTGCTAGTGGATCTTTC
GGTTTTCAAGCTTTTACTGAAAAGGATCTTGAATTCATCTCCAAATTTAAGGAAGAACAC
GGTGCTGATGTTTTTCGTCAAATTCTTCACTCCTTTTGCCCCTCTATCTATGGACATGAA
CTTGTAAAAGCTGGTATCACCCTTGCGCTTTTCGGTGGTGTGCAGAAGCACTCCATTGAT
CAAAACAAGGTCCCAGTGAGAGGAGACATTCATGCTGTTGTTGTTGGTGATCCTGGACTA
GGCAAGAGTCAACTGCTACAGGCTGCAGCAGCTGTTTCTCCACGGGGTATATATGTTTGT
GGGAATACAACAACAAATGCTGGTCTAACTGTTGCTGTGGTTAAAGATTCTATGTCAAAT
GATTATGCATTTGAGGCTGGTGCCATGGTCCTTGCTGACCGTGGAATATGCTGTATCGAT
GAGTTCGATAAAATGTCAGCAGAGCATCAGGTTTTAACCTTGTATAAGCTTCACTCTGAA
ATGTTAATTAGAAAGCCCTAACCTGCCACATCATGTTTCTAATGAATTTGAGTTCATAGG
CTTTACTGGAAGCCATGGAGCAGCAATGTGTATCTGTGGCAAAGGCTGGCCTTGTGGCAA
GTTTATCAGCCCGTACTTCTGTGCTAGCGGCTGCTAATCCTGTTGGTGGTCATT

CDS

1446 bp

>Os05t0464100-01 MCM family protein.
ATGTACGACGATGGTCCTCGCAAGGGAAAACCCGGCGgcctctccatggacgccgccacc
gccgcggggctcgcggcggtctggccggagtacttcccggaggagagcgagttcgccgcg
gacggccgcagcgcgcgcctCGCCGCCGACCTGGTCGACCTCTTCTCCTCCCCCGACGCG
AGCGACCTCCTCTCGCGAGTCGAAGATGATGGTGATATCCTCTCCCTTCCAGTTGATTTC
CAGCAGCTATCGAATTTGACCTGGATTACTGAAGCTCTCCAGGAAAATCCAAAAGAAGCC
TTGCTTTCCATGGGAGCTGCAGTTCATCTGATTGTGTGTGCTAGCAGGGACTTGCAGTTG
GGCGACATCAACAAAATCAATATCAGGCTTTACAACCACACCAAGACTATTGCCTTGAAG
AATTTAAAAGCGGCGTATATTAAGAAACTTGTGACAGTGCGTGGAACAGTCTTAAAAGTA
AGTACGGTGAAGCCTCTAGTGCTGCAGCTGAATTTCCAATGCATGAAATGCGCTACAAAA
TTCCCTCGTGTGTTCTGTGATGGGAAGTTTTCACCTCCAGTATCGTGCAGTATTCAGGGA
TGCAAGAGCAGAACATTCATACCAATGAGATCTACTGCAAAGTTGATGGATTTTCAGAAA
ATAAGGATACAAGAGCTTGCTAGTGGTGAAAGCCATGAAGAAGGCAGAGTGCCACGAACT
ATAGAGTGTGAGCTTACAGAGGATCTTGTAGATTGTTGCATCCCTGGAGAGACTGTAACA
GTTACTGGAATCGTCAAAGTACTGAACAACTACATGGATGTTGGAGGAGGGAAATCCAAA
AGCAGGAACCAAGGTTTATACTACCTGTACCTGGAAGCAATTTCAGTAAGAAACTCAAAG
GTCCATGCTGCTTCAGGAAATTCAGATGCTGCTAGTGGATCTTTCGGTTTTCAAGCTTTT
ACTGAAAAGGATCTTGAATTCATCTCCAAATTTAAGGAAGAACACGGTGCTGATGTTTTT
CGTCAAATTCTTCACTCCTTTTGCCCCTCTATCTATGGACATGAACTTGTAAAAGCTGGT
ATCACCCTTGCGCTTTTCGGTGGTGTGCAGAAGCACTCCATTGATCAAAACAAGGTCCCA
GTGAGAGGAGACATTCATGCTGTTGTTGTTGGTGATCCTGGACTAGGCAAGAGTCAACTG
CTACAGGCTGCAGCAGCTGTTTCTCCACGGGGTATATATGTTTGTGGGAATACAACAACA
AATGCTGGTCTAACTGTTGCTGTGGTTAAAGATTCTATGTCAAATGATTATGCATTTGAG
GCTGGTGCCATGGTCCTTGCTGACCGTGGAATATGCTGTATCGATGAGTTCGATAAAATG
TCAGCAGAGCATCAGGTTTTAACCTTGTATAAGCTTCACTCTGAAATGTTAATTAGAAAG
CCCTAA

Protein

482 aa

>Os05t0464100-01 MCM family protein.
MYDDGPRKGKPGGLSMDAATAAGLAAVWPEYFPEESEFAADGRSARLAADLVDLFSSPDA
SDLLSRVEDDGDILSLPVDFQQLSNLTWITEALQENPKEALLSMGAAVHLIVCASRDLQL
GDINKINIRLYNHTKTIALKNLKAAYIKKLVTVRGTVLKVSTVKPLVLQLNFQCMKCATK
FPRVFCDGKFSPPVSCSIQGCKSRTFIPMRSTAKLMDFQKIRIQELASGESHEEGRVPRT
IECELTEDLVDCCIPGETVTVTGIVKVLNNYMDVGGGKSKSRNQGLYYLYLEAISVRNSK
VHAASGNSDAASGSFGFQAFTEKDLEFISKFKEEHGADVFRQILHSFCPSIYGHELVKAG
ITLALFGGVQKHSIDQNKVPVRGDIHAVVVGDPGLGKSQLLQAAAAVSPRGIYVCGNTTT
NAGLTVAVVKDSMSNDYAFEAGAMVLADRGICCIDEFDKMSAEHQVLTLYKLHSEMLIRK
P*

5'UTR

chr05:22789273..22789407 (+ strand) : 135 bp

CDS

chr05:22789408..22789605 (+ strand) : 198 bp

chr05:22790193..22790324 (+ strand) : 132 bp

chr05:22790435..22790546 (+ strand) : 112 bp

chr05:22790633..22790853 (+ strand) : 221 bp

chr05:22790929..22791094 (+ strand) : 166 bp

chr05:22791870..22792115 (+ strand) : 246 bp

chr05:22792745..22792840 (+ strand) : 96 bp

chr05:22792937..22793089 (+ strand) : 153 bp

chr05:22793661..22793782 (+ strand) : 122 bp

3'UTR

chr05:22793783..22793935 (+ strand) : 153 bp

FASTA

>Os05t0464100-01 class=Sequence position=chr05:22789273..22793935 (+ strand)
GAGCTTCACG CCGTCCTCGC TCGCCGCGCT AAAAATTTCG CTCCGCCCGC CCCCCAACTC TCCTCTCCCG CCGCCGCCGC
CGCTGCCGCG CAACTCGCCG GAGAGAGAAG GGAGCGGCCC ATTTCTCAGG CGAACATGTA CGACGATGGT CCTCGCAAGG
GAAAACCCGG CGgcctctcc atggacgccg ccaccgccgc ggggctcgcg gcggtctggc cggagtactt cccggaggag
agcgagttcg ccgcggacgg ccgcagcgcg cgcctCGCCG CCGACCTGGT CGACCTCTTC TCCTCCCCCG ACGCGAGCGA
CCTCCTCTCG CGAGTAAGCG GTGGCTCCCC TCCCCCATTT CATTCCTCTG CGGCGTTGCC CTTCGAGCTC TCCTCACGGC
GGACCGGCGG TGCCCATGCT AGGGTTCCGC GCTTGTGGTA TGGTCCGATT GTTGAGATCG GTTCATGCGT GATCGGTGTT
ACAACTTAGA ATATATCAGT GGTGGCATTT CTCGATAATG TCTACGATTT TAGCGGATGG ACGCTCCAAT CGTTAATTGA
AATGTTCTGG AAATCGCAAC TAAAGTGAGT ACTGTGAGCA ATTCATAAAT GTTTTTCTAA GGAATCTTCG CAAGTGTTTA
CTTTGTCTTA AACAAGAGCA AGTGTTTAAG CTTGTAAAGG TTCCTGTTAT AGTGTTATTA CCTATTTAAT TTAGCTCGTT
CAGGGAGCTT GCAACTCGAT GTTAATGGGC GTTTAGTTTC TACTCTCTTA ATGCCTTAAT TGCGAATGCA TGAATTTCAT
ATGAATTAGG AAACAATTCA ATCATTGCAA GAATCTTAAA ATGCGAATTT GTAATTTACT CTCTTTGGTT AATGTGGTTA
CTAGTAGTTA CCACTTACAA CTTCATGGCT TCATGCACAG GTCGAAGATG ATGGTGATAT CCTCTCCCTT CCAGTTGATT
TCCAGCAGCT ATCGAATTTG ACCTGGATTA CTGAAGCTCT CCAGGAAAAT CCAAAAGAAG CCTTGCTTTC CATGGGAGCT
GCAGTTCATC TGGTTGATGT TTCTATTCAT GTTTTCCTAG AATTAATGAG CCTGTTACTT TTGTAGTGCT TTCATGTTTG
GTCCACTATA CCTGATATGT CAGTTCTTGA TATTTTCTTC AGATTGTGTG TGCTAGCAGG GACTTGCAGT TGGGCGACAT
CAACAAAATC AATATCAGGC TTTACAACCA CACCAAGACT ATTGCCTTGA AGAATTTAAA AGCGGCGTAT ATTAGTAAAT
GTCATTCTGC CTTTTATCAT CGCGTGCTAA AGTTTGTGCA CATATAAATC AAAGTACTAA TTTGTAGATT CACTTGGCAG
AGAAACTTGT GACAGTGCGT GGAACAGTCT TAAAAGTAAG TACGGTGAAG CCTCTAGTGC TGCAGCTGAA TTTCCAATGC
ATGAAATGCG CTACAAAATT CCCTCGTGTG TTCTGTGATG GGAAGTTTTC ACCTCCAGTA TCGTGCAGTA TTCAGGGATG
CAAGAGCAGA ACATTCATAC CAATGAGATC TACTGCAAAG TTGATGGATT TTCAGAAAAT AAGGCAAGTG ATAAATAAAC
TACTACATTA TCCTTTATTT ATGGTACTAA AGCTTTTCTC ATATTGTTTC CAAATCAGGA TACAAGAGCT TGCTAGTGGT
GAAAGCCATG AAGAAGGCAG AGTGCCACGA ACTATAGAGT GTGAGCTTAC AGAGGATCTT GTAGATTGTT GCATCCCTGG
AGAGACTGTA ACAGTTACTG GAATCGTCAA AGTACTGAAC AACTACATGG ATGTTGGAGG AGGTACAATT TTTGAGAAAT
TAATATTTCT TTGCATTACT TCTTTTTCTA AACCTTGTGG ATTTACTGGC TCACACACAG GCTTCAAATT TTGCGTTTTC
ATTGGCAATC ATTGGCAAAA AATGTTTATC TATAAATGCC TCAGATTTGT TCACAACACC TATAGAGGCA CATATGCTGT
CAGCATCTTG TTTTATTTGA TCATTAATCT GATTGGATGT TAATGTTCTG ATTAGAGAGC CTTGGCCATC TACCATGTGA
CATTACGATT TTTTTTTTCT AGATGGAGCA GTTGAAAAGA AAATAGCATT TGAGCAAAGC AAGAAAATAG CTTTCTATTT
TTTTGTTTCT TCCAGACCAT ATATCCTAAA TCTGATATAT AGAAATCAGA ATCACCAGAT CAACTCATGG ACTACTGAGC
ATAAACAGTT CATTAGAAGC ATTATTATAG TCCATGTTAA CTATAGGGAA ACCTATCTAA TGCTGTATTT GGCAGCATGA
GGGTATCTAT TTTACCTCTC CCCCACTTTA CATTCTTAGA ACTTGCAAGA TCATTTGGTC TTTGTTAGAT ATATGCATGC
TTTCTATGAG CTCCTTGAAT TTAAGAATCA AGAAATTATT TATAGGATAA TGGAGAACAA ATTAGTTATG ATGTACAGCC
TTACTATTGT TTGACCCTTA CCCGCTGATG CCATATATGC AGATAAACTC TTATTTGATC TGAGCTTCCC CCCTTCTAAT
TTCTTAATTT TACACAATAT TTCATTTGTA TCTTCAGGGA AATCCAAAAG CAGGAACCAA GGTTTATACT ACCTGTACCT
GGAAGCAATT TCAGTAAGAA ACTCAAAGGT CCATGCTGCT TCAGGAAATT CAGATGCTGC TAGTGGATCT TTCGGTTTTC
AAGCTTTTAC TGAAAAGGAT CTTGAATTCA TCTCCAAATT TAAGGAAGAA CACGGTGCTG ATGTTTTTCG TCAAATTCTT
CACTCCTTTT GCCCCTCTAT CTATGGACAT GAACTTGTAA AAGGTATTGG TATTATACTT ATCTTCCATC TACTATTTAA
TGTGGTTAAA GATTTAAATT TAATTCACTC TGAGCTGACC CAATAACGGA ATGAAATATT TTGGTGAAAC CTACCGCTCC
CCTTAATTTC TGTTTACACG AAATGAGATA ACAATTCCTT TTTTTCTTTT TATTCAATTA GTTCTGGACC GCTGCAGCAT
TTTCTGCCCA AATGATCTTC TATAGGAACT CTCTTGTGCT GCATGAAAAA AATGAGAATG TATCTCCCAA GCTCCTaaac
tgtgattttt gcaaaaactt tctatatata aattgcttag aatacttttc aaaaacaact tttgcacttt gtaataatta
attcattcgt ttgtaccctt gaatattatc ataaaatcag ataatctatc atctattcat ctattcagaa caaTCAAACT
GGGGGTGGTG AAATTGACTA AGCTACTGGT AGTTCCCGTT CTCTGAGATA TGTGTGTTCT CCTTTTCAAC TAGAGCATAC
AGCACCCATT CTACTACACT ACTGTTTACA AACATGCCAG CCCTTCTTGG TCCTTTTCCT GCTTTGCATT TTATTGCTAG
ATACAACTAA ATGAATATTT CCAATTTTTC AGCTGGTATC ACCCTTGCGC TTTTCGGTGG TGTGCAGAAG CACTCCATTG
ATCAAAACAA GGTCCCAGTG AGAGGAGACA TTCATGCTGT TGTTGTTGGT AATCCTTCAC TTATAGAGGG TCTAAGCTTC
TTGGTAAGAA TTTTCTTAGC ATTTCTCACA GTGCAATTAA AACTCTTGCT CAATGCAATT CTAGGTGATC CTGGACTAGG
CAAGAGTCAA CTGCTACAGG CTGCAGCAGC TGTTTCTCCA CGGGGTATAT ATGTTTGTGG GAATACAACA ACAAATGCTG
GTCTAACTGT TGCTGTGGTT AAAGATTCTA TGTCAAATGA TTATGCATTT GAGGCTGGTA AGCATATGAG ATTGTCCTTT
GTCCCTTCCC TAGACTGTTG TTTAAGTTCT GTTACCTAAC TGGCTGTCTG TCCTGGTGGG TTTTTGTCTT AAAACCTGTG
AGTGGAACAA AATAAGtact cccgttgttc caaaatataa ggatttctag aactcaaaac attgtactcc ctccgtccca
taatataagg gatggtatgt ccagattcat cgtattagga tgtgtcacat ccacccaaaa tcctttatat tacgggacgg
agggagtacc agatataagc atttctgggc actgattcca acgcacagaa atccatatat tttcagccaa tcagttgttt
catgttcgag aggggaatct aagcaattca aaatttgaca actgagatga ctaaaaggga atcttttccc ttaacttcat
tatttgctaa aaaaaaccta gaaatgctta tattctggaa cggaggGAGT AGGATGCAAG TGGGTCTGGT AGTATTTTTT
TTCTTGACTA ATTTAATGGC ACATACATAA AGTGGCCTAT CAAATAATTT TGACCCTTTG GTTTACAGGT GCCATGGTCC
TTGCTGACCG TGGAATATGC TGTATCGATG AGTTCGATAA AATGTCAGCA GAGCATCAGG TTTTAACCTT GTATAAGCTT
CACTCTGAAA TGTTAATTAG AAAGCCCTAA CCTGCCACAT CATGTTTCTA ATGAATTTGA GTTCATAGGC TTTACTGGAA
GCCATGGAGC AGCAATGTGT ATCTGTGGCA AAGGCTGGCC TTGTGGCAAG TTTATCAGCC CGTACTTCTG TGCTAGCGGC
TGCTAATCCT GTTGGTGGTC ATT

Locus: Os05g0464100

Loading...

Locus: Os05g0464100

Loading...