Os05t0472000-00

Locus

Os05g0472000

Description

Similar to LSH6 (LIGHT SENSITIVE HYPOCOTYLS 6).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

G1L8

CGSNL Gene Name

G1 LIKE PROTEIN 8

Oryzabase Gene Symbol Synonym(s)

OsG1L8

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AB512497 (DDBJ, Best hit)

Protein Evidence

NP_563780.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Domain of unknown function DUF640 (IPR006936)

Integrase/recombinase, N-terminal (IPR023109)

Expression Databases

TENOR (Os05t0472000-00)

Others

Oryzabase (8889)

Transcript

717 bp

>Os05t0472000-00 Similar to LSH6 (LIGHT SENSITIVE HYPOCOTYLS 6).
ATGGAGGGAGGAGGAGGTGGGGCGGACGGGCAGGCGCAGCCGGTGGCGCAGGCGCCGCCG
GCGATGCAGCCGATGCAGCAGCTGAGCAGGTACGAGTCGCAGAAGAGGAGGGACTGGAAC
ACGTTCCTGCAGTACCTGAAGAACCACCGGCCGCCGCTGACGCTGGCGAGGTGCAGCGGC
GCGCACGTCATCGAGTTCCTCAAGTACCTGGATCAGTTCGGGAAGACGAAGGTGCACGCG
TCGGGGTGCGCCTACTACGGccagccgagcccgccggcgccgtgcccgtgcccgctgcgc
caggcgtgggggtccctcgacgcgctcatcgggcgcctccgcgccgcctacgaggagagc
ggccacgcgccggagtccaaccccttcgccgcgcgcgccgtccggatCTACCTCCGCGAG
GTCCGCGACGCGCAGGCCAAGGCCCGCGGGATACCATACGAGAAGAAGAAGcgcaagcgc
acgcagcagcagcagcctcccccaccgccgccgccgccgccccagcaccagccgggcgcc
gccgccggggaggcgtcgagctcgtcgtctgctgccgccgccgccgtcgcagcagaaggc
agtggcagctccgccgccgccGCCGCCGCCACTAGCCAGACAGGAGGAGGAGGAGGAGGA
AGCACCACCACCACCACCGCTTCTGCTGCTGCACCGACCACCGCCACCCGAGTATAG

CDS

717 bp

>Os05t0472000-00 Similar to LSH6 (LIGHT SENSITIVE HYPOCOTYLS 6).
ATGGAGGGAGGAGGAGGTGGGGCGGACGGGCAGGCGCAGCCGGTGGCGCAGGCGCCGCCG
GCGATGCAGCCGATGCAGCAGCTGAGCAGGTACGAGTCGCAGAAGAGGAGGGACTGGAAC
ACGTTCCTGCAGTACCTGAAGAACCACCGGCCGCCGCTGACGCTGGCGAGGTGCAGCGGC
GCGCACGTCATCGAGTTCCTCAAGTACCTGGATCAGTTCGGGAAGACGAAGGTGCACGCG
TCGGGGTGCGCCTACTACGGccagccgagcccgccggcgccgtgcccgtgcccgctgcgc
caggcgtgggggtccctcgacgcgctcatcgggcgcctccgcgccgcctacgaggagagc
ggccacgcgccggagtccaaccccttcgccgcgcgcgccgtccggatCTACCTCCGCGAG
GTCCGCGACGCGCAGGCCAAGGCCCGCGGGATACCATACGAGAAGAAGAAGcgcaagcgc
acgcagcagcagcagcctcccccaccgccgccgccgccgccccagcaccagccgggcgcc
gccgccggggaggcgtcgagctcgtcgtctgctgccgccgccgccgtcgcagcagaaggc
agtggcagctccgccgccgccGCCGCCGCCACTAGCCAGACAGGAGGAGGAGGAGGAGGA
AGCACCACCACCACCACCGCTTCTGCTGCTGCACCGACCACCGCCACCCGAGTATAG

Protein

238 aa

>Os05t0472000-00 Similar to LSH6 (LIGHT SENSITIVE HYPOCOTYLS 6).
MEGGGGGADGQAQPVAQAPPAMQPMQQLSRYESQKRRDWNTFLQYLKNHRPPLTLARCSG
AHVIEFLKYLDQFGKTKVHASGCAYYGQPSPPAPCPCPLRQAWGSLDALIGRLRAAYEES
GHAPESNPFAARAVRIYLREVRDAQAKARGIPYEKKKRKRTQQQQPPPPPPPPPQHQPGA
AAGEASSSSSAAAAAVAAEGSGSSAAAAAATSQTGGGGGGSTTTTTASAAAPTTATRV*

CDS

chr05:23178205..23178921 (+ strand) : 717 bp

FASTA

>Os05t0472000-00 class=Sequence position=chr05:23178205..23178921 (+ strand)
ATGGAGGGAG GAGGAGGTGG GGCGGACGGG CAGGCGCAGC CGGTGGCGCA GGCGCCGCCG GCGATGCAGC CGATGCAGCA
GCTGAGCAGG TACGAGTCGC AGAAGAGGAG GGACTGGAAC ACGTTCCTGC AGTACCTGAA GAACCACCGG CCGCCGCTGA
CGCTGGCGAG GTGCAGCGGC GCGCACGTCA TCGAGTTCCT CAAGTACCTG GATCAGTTCG GGAAGACGAA GGTGCACGCG
TCGGGGTGCG CCTACTACGG ccagccgagc ccgccggcgc cgtgcccgtg cccgctgcgc caggcgtggg ggtccctcga
cgcgctcatc gggcgcctcc gcgccgccta cgaggagagc ggccacgcgc cggagtccaa ccccttcgcc gcgcgcgccg
tccggatCTA CCTCCGCGAG GTCCGCGACG CGCAGGCCAA GGCCCGCGGG ATACCATACG AGAAGAAGAA Gcgcaagcgc
acgcagcagc agcagcctcc cccaccgccg ccgccgccgc cccagcacca gccgggcgcc gccgccgggg aggcgtcgag
ctcgtcgtct gctgccgccg ccgccgtcgc agcagaaggc agtggcagct ccgccgccgc cGCCGCCGCC ACTAGCCAGA
CAGGAGGAGG AGGAGGAGGA AGCACCACCA CCACCACCGC TTCTGCTGCT GCACCGACCA CCGCCACCCG AGTATAG

Locus: Os05g0472000

Loading...

Locus: Os05g0472000

Loading...