Os05t0475400-01

Locus

Os05g0475400

Description

Similar to Alanine:glyoxylate aminotransferase-like protein (Fragment).

RAP-DB Gene Symbol Synonym(s)

Osh36

RAP-DB Gene Name Synonym(s)

alanine:glyoxylate aminotransferase-like protein

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Osh36, OsH36, H36, OsAMTR1, AMTR1

Oryzabase Gene Name Synonym(s)

alanine:glyoxylate aminotransferase-like protein, aminotransferase 1

Transcript Evidence

AK060423 (DDBJ, Best hit)

Protein Evidence

Q65WV6

Literature

Note

Manual Curation

November 25, 2016

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transaminase activity (GO:0008483)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Aminotransferase class-III (IPR005814)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Pyridoxal phosphate-dependent transferase, major domain (IPR015424)

Full-length cDNA

001-010-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0475400-01)

RiceXPro (AK060423)

Others

Oryzabase (13865)

KEGG (Os05t0475400-01)

Transcript

1497 bp

>Os05t0475400-01 Similar to Alanine:glyoxylate aminotransferase-like protein (Fragment).
AAATGCAGTACCTGTTCGACGAGGATGGCCGCCGTTACCTGGATGCTTTTGGTGGCATTG
CAACCGTTTGTTGCGGGCACTGCCATCCGGATGTTGTTGAGGCGATGGTCAACCAAGCAA
AGAGGATACAACACTCCACAGTTCTTTACCTGAATCATGCTATTGCAGATTTTGCCGAGG
CATTGGCAGCCAAAATGCCTGGTGATCTGAAGGTTGTTTTCTTCACAAATTCTGGCACGG
AGGCGAACGAGCTTGCACTGATGATTGCCCGGCTTTACACTGGTTGCCATGACATTATTT
CACTCAGGAATGGATACCACGGGAATGCGGCTGGAACAATGGGTGCTACCGCTCAATGCA
ACTGGAAATTTAATGTTGTTCAGACGGGAGTGCACCATGCACTTAATCCAGACCCATATA
GAGGTGCTTTCGGTTCTGATGGCGAAAAGTATGCCCGAGATGTTCAGGAAATCATTGATT
TTGGAACTACAGGAAGGGTCGGTGGTTTCATTTCGGAAGCCATACAGGGAGTGGGTGGAA
TAGTGGAACTGGCACCAGGATACTTGCCTGCTGTGTACAATATGGTAAGGAAAGCTGGCG
GCCTCTGCATCGCCGACGAAGTTCAGGCGGGAGTCGCACGAACTGGAAGCCACTTCTGGG
GATTTGAATCGCACGGCGTCATCCCAGACATAGTTACAATGGCAAAGGGTATAGGCAATG
GCATACCGATCGGAGCAGTCGTCACAACCCCTGAGATCGCTCAGGTGTTAACCCGCAGGA
GCTACTTCAACACCTTCGGTGGCAACCCTGTCAGCACAGCCGGTGGCCATGCTGTTCTCA
AGGTTCTGGAGAAGGAGAAGCTCCAGGAGAACGCATTTGTGGTTGGCTCCTACCTGAAGG
AACGGCTCAACAAGCTGAAAGAGAAGCATGACATCATTGGTGATGTTAGAGGGAAAGGCT
TCCTTCTTGGGGTTGAGCTGGTGACCGATCGCCAGAAGAAGACACCGGCCAAAGTTGAGA
TCGGTCATGTCATGAACCACATGAAAGACATGGGTGTGCTGGTTGGGAAAGGTGGTTTCT
ACGGGAACGTGTTCAGAGTAACACCTCCACTATGCTTCACCAAAGAGGACTCCGATTTCT
TCATTGAGGCGATGGACATTTCACTATCGAAGCTGTGAGTCGGAGAGGGACTGGCAGGAT
CAACCTGTCCGCATGTGATCCGTATCCATAAATAATGTTGGGGATTGGTGAGATAGCACC
TCGTTGTCTCGTAATATGTCCTGCAAACCCACCATGCGCTGCTCAACACATGGTCCAATA
GGCGCTCCTCCGGTCTCTAATCAGATGTGTTGTGACTCGTGACCAATAAGCGCATGTCAA
TGTCAGATGTATTGTTATAGTTATTGTTTACATGCTGAACGACAAAACGAACCAATCACA
ATGCCCAGGCGATGTAAATGTTGAAACAATTATATTGGCAAATGTCAGTGATTTCGC

CDS

1176 bp

>Os05t0475400-01 Similar to Alanine:glyoxylate aminotransferase-like protein (Fragment).
ATGCAGTACCTGTTCGACGAGGATGGCCGCCGTTACCTGGATGCTTTTGGTGGCATTGCA
ACCGTTTGTTGCGGGCACTGCCATCCGGATGTTGTTGAGGCGATGGTCAACCAAGCAAAG
AGGATACAACACTCCACAGTTCTTTACCTGAATCATGCTATTGCAGATTTTGCCGAGGCA
TTGGCAGCCAAAATGCCTGGTGATCTGAAGGTTGTTTTCTTCACAAATTCTGGCACGGAG
GCGAACGAGCTTGCACTGATGATTGCCCGGCTTTACACTGGTTGCCATGACATTATTTCA
CTCAGGAATGGATACCACGGGAATGCGGCTGGAACAATGGGTGCTACCGCTCAATGCAAC
TGGAAATTTAATGTTGTTCAGACGGGAGTGCACCATGCACTTAATCCAGACCCATATAGA
GGTGCTTTCGGTTCTGATGGCGAAAAGTATGCCCGAGATGTTCAGGAAATCATTGATTTT
GGAACTACAGGAAGGGTCGGTGGTTTCATTTCGGAAGCCATACAGGGAGTGGGTGGAATA
GTGGAACTGGCACCAGGATACTTGCCTGCTGTGTACAATATGGTAAGGAAAGCTGGCGGC
CTCTGCATCGCCGACGAAGTTCAGGCGGGAGTCGCACGAACTGGAAGCCACTTCTGGGGA
TTTGAATCGCACGGCGTCATCCCAGACATAGTTACAATGGCAAAGGGTATAGGCAATGGC
ATACCGATCGGAGCAGTCGTCACAACCCCTGAGATCGCTCAGGTGTTAACCCGCAGGAGC
TACTTCAACACCTTCGGTGGCAACCCTGTCAGCACAGCCGGTGGCCATGCTGTTCTCAAG
GTTCTGGAGAAGGAGAAGCTCCAGGAGAACGCATTTGTGGTTGGCTCCTACCTGAAGGAA
CGGCTCAACAAGCTGAAAGAGAAGCATGACATCATTGGTGATGTTAGAGGGAAAGGCTTC
CTTCTTGGGGTTGAGCTGGTGACCGATCGCCAGAAGAAGACACCGGCCAAAGTTGAGATC
GGTCATGTCATGAACCACATGAAAGACATGGGTGTGCTGGTTGGGAAAGGTGGTTTCTAC
GGGAACGTGTTCAGAGTAACACCTCCACTATGCTTCACCAAAGAGGACTCCGATTTCTTC
ATTGAGGCGATGGACATTTCACTATCGAAGCTGTGA

Protein

392 aa

>Os05t0475400-01 Similar to Alanine:glyoxylate aminotransferase-like protein (Fragment).
MQYLFDEDGRRYLDAFGGIATVCCGHCHPDVVEAMVNQAKRIQHSTVLYLNHAIADFAEA
LAAKMPGDLKVVFFTNSGTEANELALMIARLYTGCHDIISLRNGYHGNAAGTMGATAQCN
WKFNVVQTGVHHALNPDPYRGAFGSDGEKYARDVQEIIDFGTTGRVGGFISEAIQGVGGI
VELAPGYLPAVYNMVRKAGGLCIADEVQAGVARTGSHFWGFESHGVIPDIVTMAKGIGNG
IPIGAVVTTPEIAQVLTRRSYFNTFGGNPVSTAGGHAVLKVLEKEKLQENAFVVGSYLKE
RLNKLKEKHDIIGDVRGKGFLLGVELVTDRQKKTPAKVEIGHVMNHMKDMGVLVGKGGFY
GNVFRVTPPLCFTKEDSDFFIEAMDISLSKL*

5'UTR

chr05:23358449..23358450 (- strand) : 2 bp

CDS

chr05:23358239..23358448 (- strand) : 210 bp

chr05:23357955..23358125 (- strand) : 171 bp

chr05:23357657..23357800 (- strand) : 144 bp

chr05:23357368..23357547 (- strand) : 180 bp

chr05:23357032..23357257 (- strand) : 226 bp

chr05:23356812..23356925 (- strand) : 114 bp

chr05:23356639..23356725 (- strand) : 87 bp

chr05:23356488..23356531 (- strand) : 44 bp

3'UTR

chr05:23356169..23356487 (- strand) : 319 bp

FASTA

>Os05t0475400-01 class=Sequence position=chr05:23356169..23358450 (- strand)
AAATGCAGTA CCTGTTCGAC GAGGATGGCC GCCGTTACCT GGATGCTTTT GGTGGCATTG CAACCGTTTG TTGCGGGCAC
TGCCATCCGG ATGTTGTTGA GGCGATGGTC AACCAAGCAA AGAGGATACA ACACTCCACA GTTCTTTACC TGAATCATGC
TATTGCAGAT TTTGCCGAGG CATTGGCAGC CAAAATGCCT GGTGATCTGA AGGTAGCTTG AGAAAACTGG ACTTTCTCTA
TCCGAATATT GCTAATTGTT TAGAAATACA TGAAGATTGT TTTGCCTGTT GAAAGCTTTA CCTGAATCTG TTCCTTTCTT
TTCAGGTTGT TTTCTTCACA AATTCTGGCA CGGAGGCGAA CGAGCTTGCA CTGATGATTG CCCGGCTTTA CACTGGTTGC
CATGACATTA TTTCACTCAG GAATGGATAC CACGGGAATG CGGCTGGAAC AATGGGTGCT ACCGCTCAAT GCAACTGGAA
ATTTAATGTT GTTCAGGCAA GTGTTGGTCC TGTTTTCGCT TACAGCATTA GGTATTGAGT AAACACGCAG GACTTAAAAC
TGCGACTTTT GTTGTTTCAA AAAAAAAAAA ACTGCGACTA Ttacatgtaa atcattgaaa ctaatgatta ttcatttata
atttgttCAG ACGGGAGTGC ACCATGCACT TAATCCAGAC CCATATAGAG GTGCTTTCGG TTCTGATGGC GAAAAGTATG
CCCGAGATGT TCAGGAAATC ATTGATTTTG GAACTACAGG AAGGGTCGGT GGTTTCATTT CGGAAGCCAT ACAGGTACAT
ATATCAATCT CAATGCATTA TCATACAATG GCCATCTTAT TTGTCATTTC GATCAACAGT GATTTCTTAT CATTCTGAAA
ACGAGTTCTT TTTCCTCCTC CAGGGAGTGG GTGGAATAGT GGAACTGGCA CCAGGATACT TGCCTGCTGT GTACAATATG
GTAAGGAAAG CTGGCGGCCT CTGCATCGCC GACGAAGTTC AGGCGGGAGT CGCACGAACT GGAAGCCACT TCTGGGGATT
TGAATCGCAC GGCGTCATCC CAGACATAGT TACAATGGCA AAGGTGAATC TTGAGGATCC TTCCATAACA TTCAGAGTTT
CAGACTCAAT TCATCCCTCC TTTGACGAAT ACAATCTTTG GGAAACTCAC ATGTTCCTTC TCTTCATCTT CAGGGTATAG
GCAATGGCAT ACCGATCGGA GCAGTCGTCA CAACCCCTGA GATCGCTCAG GTGTTAACCC GCAGGAGCTA CTTCAACACC
TTCGGTGGCA ACCCTGTCAG CACAGCCGGT GGCCATGCTG TTCTCAAGGT TCTGGAGAAG GAGAAGCTCC AGGAGAACGC
ATTTGTGGTT GGCTCCTACC TGAAGGAACG GCTCAACAAG CTGAAAGAGA AGCATGACAG TGAGTATCAG TAACTAAGAT
AAAATCAGTA AAATCACGTT GCAACCACAT GGATCCAGGG TAGATTTGTT CCTTACATTT TGGCTTGTAT GGATGGATTT
TCCAGTCATT GGTGATGTTA GAGGGAAAGG CTTCCTTCTT GGGGTTGAGC TGGTGACCGA TCGCCAGAAG AAGACACCGG
CCAAAGTTGA GATCGGTCAT GTCATGAACC ACATGAAAGG TACTACTGAT CCTCTCAGCC TCTTCCAGTT TTGTTACTGA
AAGATCTCAC CATGAGTGAT TTCTGAACTT TCTTCTTTGA CACAGACATG GGTGTGCTGG TTGGGAAAGG TGGTTTCTAC
GGGAACGTGT TCAGAGTAAC ACCTCCACTA TGCTTCACCA AAGAGGACTC CGGTAAGACC TGCTACTCTG CTGCTGATAA
ATTGTCAATA CATGTTTCAG TAATTTCTGA TCCATGACTG TAACATGGTT TGATGAACAA CGTATCTTGC TGCATGCAGA
TTTCTTCATT GAGGCGATGG ACATTTCACT ATCGAAGCTG TGAGTCGGAG AGGGACTGGC AGGATCAACC TGTCCGCATG
TGATCCGTAT CCATAAATAA TGTTGGGGAT TGGTGAGATA GCACCTCGTT GTCTCGTAAT ATGTCCTGCA AACCCACCAT
GCGCTGCTCA ACACATGGTC CAATAGGCGC TCCTCCGGTC TCTAATCAGA TGTGTTGTGA CTCGTGACCA ATAAGCGCAT
GTCAATGTCA GATGTATTGT TATAGTTATT GTTTACATGC TGAACGACAA AACGAACCAA TCACAATGCC CAGGCGATGT
AAATGTTGAA ACAATTATAT TGGCAAATGT CAGTGATTTC GC

Locus: Os05g0475400

Loading...

Locus: Os05g0475400

Loading...