Os05t0475400-02

Locus

Os05g0475400

Description

Aminotransferase, Regulation of abiotic stress responses

RAP-DB Gene Symbol Synonym(s)

Osh36, OsAMTR1, AMTR1

RAP-DB Gene Name Synonym(s)

alanine:glyoxylate aminotransferase-like protein, aminotransferase 1

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Osh36, OsH36, H36, OsAMTR1, AMTR1

Oryzabase Gene Name Synonym(s)

alanine:glyoxylate aminotransferase-like protein, aminotransferase 1

Transcript Evidence

Inferred from literature (indica)

Protein Evidence

Q65WV6

Literature

PMID: 27486471

Note

Manual Curation

November 25, 2016

Gene Ontology (GO)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: transaminase activity (GO:0008483)

Molecular Function: pyridoxal phosphate binding (GO:0030170)

Functional domain (InterPro)

Aminotransferase class-III (IPR005814)

Pyridoxal phosphate-dependent transferase (IPR015424)

Pyridoxal phosphate-dependent transferase, major region, subdomain 1 (IPR015421)

Pyridoxal phosphate-dependent transferase, major region, subdomain 2 (IPR015422)

Others

Oryzabase (13865)

Transcript

1530 bp

>Os05t0475400-02 Aminotransferase, Regulation of abiotic stress responses
GCCGGGAAGGAAGCCAACGCCGACGCCGACATGCAGCGCCTCGCCTCCTCCCGGAGGCTC
CTCCAGGCGGCGCTCGCCCCTGTCCGTGCCGCCGTACGACGGGCCGCGGGCGGAGGAGAT
CTCCCGGAAGCGGGCCGAGTTCCTCAGCCCCTCCCTCTTCCACTTCTACGACCGCCCTTT
GAACATAGTCGATGGGAAAATGCAGTACCTGTTCGACGAGGATGGCCGCCGTTACCTGGA
TGCTTTTGGTGGCATTGCAACCGTTTGTTGCGGGCACTGCCATCCGGATGTTGTTGAGGC
GATGGTCAACCAAGCAAAGAGGATACAACACTCCACAGTTCTTTACCTGAATCATGCTAT
TGCAGATTTTGCCGAGGCATTGGCAGCCAAAATGCCTGGTGATCTGAAGGTTGTTTTCTT
CACAAATTCTGGCACGGAGGCGAACGAGCTTGCACTGATGATTGCCCGGCTTTACACTGG
TTGCCATGACATTATTTCACTCAGGAATGGATACCACGGGAATGCGGCTGGAACAATGGG
TGCTACCGCTCAATGCAACTGGAAATTTAATGTTGTTCAGACGGGAGTGCACCATGCACT
TAATCCAGACCCATATAGAGGTGCTTTCGGTTCTGATGGCGAAAAGTATGCCCGAGATGT
TCAGGAAATCATTGATTTTGGAACTACAGGAAGGGTCGGTGGTTTCATTTCGGAAGCCAT
ACAGGGAGTGGGTGGAATAGTGGAACTGGCACCAGGATACTTGCCTGCTGTGTACAATAT
GGTAAGGAAAGCTGGCGGCCTCTGCATCGCCGACGAAGTTCAGGCGGGAGTCGCACGAAC
TGGAAGCCACTTCTGGGGATTTGAATCGCACGGCGTCATCCCAGACATAGTTACAATGGC
AAAGGGTATAGGCAATGGCATACCGATCGGAGCAGTCGTCACAACCCCTGAGATCGCTCA
GGTGTTAACCCGCAGGAGCTACTTCAACACCTTCGGTGGCAACCCTGTCAGCACAGCCGG
TGGCCATGCTGTTCTCAAGGTTCTGGAGAAGGAGAAGCTCCAGGAGAACGCATTTGTGGT
TGGCTCCTACCTGAAGGAACGGCTCAACAAGCTGAAAGAGAAGCATGACATCATTGGTGA
TGTTAGAGGGAAAGGCTTCCTTCTTGGGGTTGAGCTGGTGACCGATCGCCAGAAGAAGAC
ACCGGCCAAAGTTGAGATCGGTCATGTCATGAACCACATGAAAGACATGGGTGTGCTGGT
TGGGAAAGGTGGTTTCTACGGGAACGTGTTCAGAGTAACACCTCCACTATGCTTCACCAA
AGAGGACTCCGATTTCTTCATTGAGGCGATGGACATTTCACTATCGAAGCTGTGAGTCGG
AGAGGGACTGGCAGGATCAACCTGTCCGCATGTGATCCGTATCCATAAATAATGTTGGGG
ATTGGTGAGATAGCACCTCGTTGTCTCGTAATATGTCCTGCAAACCCACCATGCGCTGCT
CAACACATGGTCCAATAGGCGCTCCTCCGG

CDS

1176 bp

>Os05t0475400-02 Aminotransferase, Regulation of abiotic stress responses
ATGCAGTACCTGTTCGACGAGGATGGCCGCCGTTACCTGGATGCTTTTGGTGGCATTGCA
ACCGTTTGTTGCGGGCACTGCCATCCGGATGTTGTTGAGGCGATGGTCAACCAAGCAAAG
AGGATACAACACTCCACAGTTCTTTACCTGAATCATGCTATTGCAGATTTTGCCGAGGCA
TTGGCAGCCAAAATGCCTGGTGATCTGAAGGTTGTTTTCTTCACAAATTCTGGCACGGAG
GCGAACGAGCTTGCACTGATGATTGCCCGGCTTTACACTGGTTGCCATGACATTATTTCA
CTCAGGAATGGATACCACGGGAATGCGGCTGGAACAATGGGTGCTACCGCTCAATGCAAC
TGGAAATTTAATGTTGTTCAGACGGGAGTGCACCATGCACTTAATCCAGACCCATATAGA
GGTGCTTTCGGTTCTGATGGCGAAAAGTATGCCCGAGATGTTCAGGAAATCATTGATTTT
GGAACTACAGGAAGGGTCGGTGGTTTCATTTCGGAAGCCATACAGGGAGTGGGTGGAATA
GTGGAACTGGCACCAGGATACTTGCCTGCTGTGTACAATATGGTAAGGAAAGCTGGCGGC
CTCTGCATCGCCGACGAAGTTCAGGCGGGAGTCGCACGAACTGGAAGCCACTTCTGGGGA
TTTGAATCGCACGGCGTCATCCCAGACATAGTTACAATGGCAAAGGGTATAGGCAATGGC
ATACCGATCGGAGCAGTCGTCACAACCCCTGAGATCGCTCAGGTGTTAACCCGCAGGAGC
TACTTCAACACCTTCGGTGGCAACCCTGTCAGCACAGCCGGTGGCCATGCTGTTCTCAAG
GTTCTGGAGAAGGAGAAGCTCCAGGAGAACGCATTTGTGGTTGGCTCCTACCTGAAGGAA
CGGCTCAACAAGCTGAAAGAGAAGCATGACATCATTGGTGATGTTAGAGGGAAAGGCTTC
CTTCTTGGGGTTGAGCTGGTGACCGATCGCCAGAAGAAGACACCGGCCAAAGTTGAGATC
GGTCATGTCATGAACCACATGAAAGACATGGGTGTGCTGGTTGGGAAAGGTGGTTTCTAC
GGGAACGTGTTCAGAGTAACACCTCCACTATGCTTCACCAAAGAGGACTCCGATTTCTTC
ATTGAGGCGATGGACATTTCACTATCGAAGCTGTGA

Protein

392 aa

>Os05t0475400-02 Aminotransferase, Regulation of abiotic stress responses
MQYLFDEDGRRYLDAFGGIATVCCGHCHPDVVEAMVNQAKRIQHSTVLYLNHAIADFAEA
LAAKMPGDLKVVFFTNSGTEANELALMIARLYTGCHDIISLRNGYHGNAAGTMGATAQCN
WKFNVVQTGVHHALNPDPYRGAFGSDGEKYARDVQEIIDFGTTGRVGGFISEAIQGVGGI
VELAPGYLPAVYNMVRKAGGLCIADEVQAGVARTGSHFWGFESHGVIPDIVTMAKGIGNG
IPIGAVVTTPEIAQVLTRRSYFNTFGGNPVSTAGGHAVLKVLEKEKLQENAFVVGSYLKE
RLNKLKEKHDIIGDVRGKGFLLGVELVTDRQKKTPAKVEIGHVMNHMKDMGVLVGKGGFY
GNVFRVTPPLCFTKEDSDFFIEAMDISLSKL*

5'UTR

chr05:23359935..23360022 (- strand) : 88 bp

chr05:23359747..23359836 (- strand) : 90 bp

chr05:23358449..23358469 (- strand) : 21 bp

CDS

chr05:23358239..23358448 (- strand) : 210 bp

chr05:23357955..23358125 (- strand) : 171 bp

chr05:23357657..23357800 (- strand) : 144 bp

chr05:23357368..23357547 (- strand) : 180 bp

chr05:23357032..23357257 (- strand) : 226 bp

chr05:23356812..23356925 (- strand) : 114 bp

chr05:23356639..23356725 (- strand) : 87 bp

chr05:23356488..23356531 (- strand) : 44 bp

3'UTR

chr05:23356333..23356487 (- strand) : 155 bp

FASTA

>Os05t0475400-02 class=Sequence position=chr05:23356333..23360022 (- strand)
GCCGGGAAGG AAGCCAACGC CGACGCCGAC ATGCAGCGCC TCGCCTCCTC CCGGAGGCTC CTCCAGGCGG CGCTCGCCCC
TGTCCGTGCC CAGTCCAGCC TCTCCGCCGC GGCGGCCGCC GCCGCGCCCG CGCCGGAGAA TGCCTTCGCC GCCGCCCCGA
AGATGCCGCC GTTCGACTAC ACGCCGCCGC CGTACGACGG GCCGCGGGCG GAGGAGATCT CCCGGAAGCG GGCCGAGTTC
CTCAGCCCCT CCCTCTTCCA CTTCTACGAC CGCCCTGTAC GTTACGCCAC GATCTTTTCA CCGCTCCCAT TTCTTTGGAA
CGATTTGGGG GGAAAACACT GTAGTATTAC AGATCGGATT CTTGATTGTT TATACCTTAA ATTAGAAAGA AATACTGCAA
TTTTGTCTCT ATAACAAGAC GCATTTTTCC ATTTTACATC CAAATGCTGC CACAAATGCA TCGGCGTTCG GCGATGTTCA
GAGATGATCA GGCTCGTAGC TTAAACAAAT CTCCTTAATT TGTTTGCAAA GGCTGTTGTT TTCTCTGTTT TTTTATGATC
TCTTGCTGGT GGCTTATTAG TGTATCTTGT TACAAGAAAA GGCAGCCCTT TTGGAAGTGC AACGTCTTTT TCTGTCGCTA
TTGGATAGGT TTGGTTGGAA TGCCATTTTA CCTGTTCTTA CTTCTTACTC TGAGCATTTC TTACTTCTTA CCGTTTGGAG
TGGGCTTACC GCCACCCGCG GTTTGGCAGT TATCGCGATT ATCACAAGGT ATCCCGTGGT TTTAAAAACT GAAAAGATTA
CCGTATACTG TTTGGTAAAC CTCACAAGAT GCTCTGCAGA ATCTCCAAGA TAGTCGTACT ACTAATTGTA GTATGGGGAA
TTGTGAATCT AGTACAAAAA TGTAGTTGTC TTTTCTCTTT CCCATAACAT AGATGTTCTG TTCTGCTTAG TAAAAACGTC
AGCCTCTATG TTCTTGTCTG CAAATATGCA TAGTTAAGAA GAAATAATTT TTTTTTATCT TGTGAATAGT AGTAGGTCAG
TTTGCTCAAC TACGTCTTGT GCTAGTAGTC TGCTAGATCT CAAACATATG TGGCTGCGCC AATAACATAT GCATATGTCT
CTCTCTAAAA TAGCTTCATA ACTGACACCT TTCCATTTTA AAATTGCACA TGCATTGCCA AGTACTCTAT AAACAATGTT
AAAGATTGGA TTCCTGAAGG AGGATATAGC ACCAACCAAA CTGTGCACCT AACATTGTGT CTTGCTGACT CCTCTCATCA
CTGGAGATCA TGCACATTGC TAAACTCCTC GTGAACCATC TGAAAAATAC TTTTTGACAG GGACGTTTAT CTGGTTGATA
AAATTGGTAG GAAGAAAAAG AAAACAACAA TAGCTCTTTG AGATCACCTT GAATTCTTTA GAAGAGGGTT ATTAAAAATT
TTCTAAAAAG GGAAAATTCT CGTTCTAAAA CATATCAATA TGTGATAAAG ATATGGTTTT TGGAGATTTC AAGTTCCAAA
AACTGACCAT TTAGTATGTA ACAAACATTT CAGTTGAACA TAGTCGATGG GAAAATGCAG TACCTGTTCG ACGAGGATGG
CCGCCGTTAC CTGGATGCTT TTGGTGGCAT TGCAACCGTT TGTTGCGGGC ACTGCCATCC GGATGTTGTT GAGGCGATGG
TCAACCAAGC AAAGAGGATA CAACACTCCA CAGTTCTTTA CCTGAATCAT GCTATTGCAG ATTTTGCCGA GGCATTGGCA
GCCAAAATGC CTGGTGATCT GAAGGTAGCT TGAGAAAACT GGACTTTCTC TATCCGAATA TTGCTAATTG TTTAGAAATA
CATGAAGATT GTTTTGCCTG TTGAAAGCTT TACCTGAATC TGTTCCTTTC TTTTCAGGTT GTTTTCTTCA CAAATTCTGG
CACGGAGGCG AACGAGCTTG CACTGATGAT TGCCCGGCTT TACACTGGTT GCCATGACAT TATTTCACTC AGGAATGGAT
ACCACGGGAA TGCGGCTGGA ACAATGGGTG CTACCGCTCA ATGCAACTGG AAATTTAATG TTGTTCAGGC AAGTGTTGGT
CCTGTTTTCG CTTACAGCAT TAGGTATTGA GTAAACACGC AGGACTTAAA ACTGCGACTT TTGTTGTTTC AAAAAAAAAA
AAACTGCGAC TATtacatgt aaatcattga aactaatgat tattcattta taatttgttC AGACGGGAGT GCACCATGCA
CTTAATCCAG ACCCATATAG AGGTGCTTTC GGTTCTGATG GCGAAAAGTA TGCCCGAGAT GTTCAGGAAA TCATTGATTT
TGGAACTACA GGAAGGGTCG GTGGTTTCAT TTCGGAAGCC ATACAGGTAC ATATATCAAT CTCAATGCAT TATCATACAA
TGGCCATCTT ATTTGTCATT TCGATCAACA GTGATTTCTT ATCATTCTGA AAACGAGTTC TTTTTCCTCC TCCAGGGAGT
GGGTGGAATA GTGGAACTGG CACCAGGATA CTTGCCTGCT GTGTACAATA TGGTAAGGAA AGCTGGCGGC CTCTGCATCG
CCGACGAAGT TCAGGCGGGA GTCGCACGAA CTGGAAGCCA CTTCTGGGGA TTTGAATCGC ACGGCGTCAT CCCAGACATA
GTTACAATGG CAAAGGTGAA TCTTGAGGAT CCTTCCATAA CATTCAGAGT TTCAGACTCA ATTCATCCCT CCTTTGACGA
ATACAATCTT TGGGAAACTC ACATGTTCCT TCTCTTCATC TTCAGGGTAT AGGCAATGGC ATACCGATCG GAGCAGTCGT
CACAACCCCT GAGATCGCTC AGGTGTTAAC CCGCAGGAGC TACTTCAACA CCTTCGGTGG CAACCCTGTC AGCACAGCCG
GTGGCCATGC TGTTCTCAAG GTTCTGGAGA AGGAGAAGCT CCAGGAGAAC GCATTTGTGG TTGGCTCCTA CCTGAAGGAA
CGGCTCAACA AGCTGAAAGA GAAGCATGAC AGTGAGTATC AGTAACTAAG ATAAAATCAG TAAAATCACG TTGCAACCAC
ATGGATCCAG GGTAGATTTG TTCCTTACAT TTTGGCTTGT ATGGATGGAT TTTCCAGTCA TTGGTGATGT TAGAGGGAAA
GGCTTCCTTC TTGGGGTTGA GCTGGTGACC GATCGCCAGA AGAAGACACC GGCCAAAGTT GAGATCGGTC ATGTCATGAA
CCACATGAAA GGTACTACTG ATCCTCTCAG CCTCTTCCAG TTTTGTTACT GAAAGATCTC ACCATGAGTG ATTTCTGAAC
TTTCTTCTTT GACACAGACA TGGGTGTGCT GGTTGGGAAA GGTGGTTTCT ACGGGAACGT GTTCAGAGTA ACACCTCCAC
TATGCTTCAC CAAAGAGGAC TCCGGTAAGA CCTGCTACTC TGCTGCTGAT AAATTGTCAA TACATGTTTC AGTAATTTCT
GATCCATGAC TGTAACATGG TTTGATGAAC AACGTATCTT GCTGCATGCA GATTTCTTCA TTGAGGCGAT GGACATTTCA
CTATCGAAGC TGTGAGTCGG AGAGGGACTG GCAGGATCAA CCTGTCCGCA TGTGATCCGT ATCCATAAAT AATGTTGGGG
ATTGGTGAGA TAGCACCTCG TTGTCTCGTA ATATGTCCTG CAAACCCACC ATGCGCTGCT CAACACATGG TCCAATAGGC
GCTCCTCCGG 

Locus: Os05g0475400

Loading...

Locus: Os05g0475400

Loading...