Os05t0476200-01

Locus

Os05g0476200

Description

Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM3

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 3

Oryzabase Gene Symbol Synonym(s)

OsMCM3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK063430 (DDBJ, Best hit)

Protein Evidence

NP_001105718.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

ATPase, AAA+ type, core (IPR003593)

Mini-chromosome maintenance complex protein 3 (IPR008046)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

001-115-D09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0476200-01)

RiceXPro (AK063430)

Others

Oryzabase (9201)

KEGG (Os05t0476200-01)

Transcript

2659 bp

>Os05t0476200-01 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
AAATCCGAACCCGCCGCCACAATCCCCCGCCCATTCCCGGCTTCCCGCTCCTCTCTCTCT
CCCTCCCCTCCGGTCGCGCGTCCCGTCTCCGGAGCAGCAGCCATGGACGTCAACGAGGAG
GCAATGGCGGCGCACAAGCGCGCGTTCCTCGACTTCCTCGACCAGGATGTCGGGAAGGGG
GTGTACATGCAGGCCGTGCGCGACATGGTGCAGAACAAGCGCCACCGGCTCATCATCGGC
ATGGACGACCTCCGGAACCACAGCCTCGATCTCGCCCGCAGGGTGATACGGAGCCCCGCG
GAGTACATGCAGCCGGCGTCGGACGCGGTGACGGAGGTGGCGAGGAACCTGGACCCCAAG
TTCTTGAAGGAAGGGCAGCGCGTGCTGGTGGGATTCTCGGGGCCCTTCGGCTTCCACAGG
GTCACGCCCAGGGACCTCATGTCGTCCTTCATCGGGACTATGGTCTGCGTCGAGGGCATC
GTCACGAAATGTTCACTAGTAAGGCCGAAAGTTGTTAAGAGTGTTCACTATTGCCCTGCT
ACTGGAGGTACTCTCTCACGTGAATACAGGGACATCACATCTTTCGTAGGCCTACCTACT
GGTTCGGTTTATCCAACAAGGGATGAAAATGGTAACTTGTTGGTCACTGAGTACGGGATG
TGTGAATACAAGGATCACCAAACACTCTCCATGCAAGAAGTGCCTGAAAATTCTGCCCCT
GGACAGCTCCCAAGAACAGTGGACATTATTGTAGAAGATGACCTAGTAGATTCTTGCAAG
CCAGGTGACCGAGTATCAATTGTTGGTGTTTACAAGGCTCTTCCAGGGAAAAGCAAGGGC
AGTGTTAGTGGTGTGTTCAGGACTGTCCTTATTGCAAACAATGTTTCACTTATGAACAAA
GAAGCAAATGCACCTGTCTATACTCGGGAGGATTTGAAGAGGATGAAAGAAATATCAAGG
AGAAATGACACATTTGACTTACTAGGAAATTCACTTGCTCCATCTATATATGGCCATCTG
TGGATAAAGAAAGCAGTAGTTCTATTAATGCTTGGTGGTGTAGAGAAGAATCTGAAGAAT
GGAACTCACTTGAGAGGAGATATAAACATGATGATGGTAGGAGATCCTTCAGTTGCCAAG
TCCCAGCTCCTAAGAGCGGTTATGAACATTGCCCCTTTGGCTATTTCAACTACTGGAAGG
GGTTCATCTGGTGTTGGTTTGACCGCTGCTGTCACTTCTGATCAAGAGACTGGTGAGAGA
AGGCTGGAGGCTGGTGCCATGGTTCTTGCTGATCGTGGTGTTGTCTGCATTGATGAGTTT
GATAAGATGAATGATCAGGACCGAGTGGCTATTCATGAAGTTATGGAACAGCAAACTGTG
ACGATTGCAAAGGCAGGAATTCATGCGTCACTAAATGCGAGATGTAGTGTGATTGCTGCA
GCAAATCCAATATATGGAACTTATGACCGTTCATTGACACCAACCAAGAACATTGGGCTT
CCAGATTCATTACTCTCACGTTTTGATTTGCTTTTTATTGTTCTTGATCAAATGGATCCT
GAGATTGATCGTCAAATTTCTGAACATGTTGCACGGATGCATAGATATTGCACTGATGAT
GGAGGAGCAAGATCTCTTGATAAAACAGGATATGCTGAAGAAGATGATGGTGATGTTAAT
GCAGCCATATTTGTTAAATATGATAGAATGCTCCATGGGCAGGACAGAAGGAGAGGCAAG
AAATCCAAACAGGACAGACTGACTGTCAAATTCCTGAAGAAATATATTCATTATGCAAAG
AACCTTATTCAGCCAAGACTAACTGATGAGGCATCTGATCATATTGCAACTTCATATGCT
GAGCTCAGGGATGGTGGTGCAAATGCAAAGTCTGGTGGAGGTACACTTCCGATCACAGCG
AGGACACTGGAAACCATAATTCGTCTATCTACTGCTCATGCCAAGATGAAATTGAGACAT
GAGgttctaaaaactgacgttgaagctgcactgcaagttctgaattttgcaatataccac
aaagagttaactgagatggaagagcgtgaacagagagagatggaaatgaAACAACAAGCT
GATCATGATGCAGGTGCAAGTGGTGGTAATGCAGATGAGCATAGAAGttctggaaacgac
ccaatggatgtggatgtaggaaatgcatcgaatgatcaggatgttcctgcggagagaatt
gaagcatttgaggcgattcttggtcagcatgtgttggcaaatcatctcgatcaaatatca
attgacgaaattgagcaaactgttaatagagaggcagctgcaccttacaatagacgtcaa
gtagaattcattttggagaggatgcaagatgcaaacaggataatgatacgagatggcatc
gttcggatAATCTAACTTCAAAAATCATGTCTTGCATTGTGGACAAGCTGATTACTGTGC
ATCATCCTTGTCTTTTTCATCTGATACTTAGCCAGTTTGGCATTGCAGAATGTCTGCATC
TGCACCGGAGGTTGATGTACCCGTGTATCTTAATTTTTAACAGCGAGATTTATGATGATC
ATCTGTGTCTTTGTACTTTAAATTCATGTACCGTAACGTAACAATTCTCCTGATCTAGTG
ATATGTAGTCCCTGATTTT

CDS

2313 bp

>Os05t0476200-01 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
ATGGACGTCAACGAGGAGGCAATGGCGGCGCACAAGCGCGCGTTCCTCGACTTCCTCGAC
CAGGATGTCGGGAAGGGGGTGTACATGCAGGCCGTGCGCGACATGGTGCAGAACAAGCGC
CACCGGCTCATCATCGGCATGGACGACCTCCGGAACCACAGCCTCGATCTCGCCCGCAGG
GTGATACGGAGCCCCGCGGAGTACATGCAGCCGGCGTCGGACGCGGTGACGGAGGTGGCG
AGGAACCTGGACCCCAAGTTCTTGAAGGAAGGGCAGCGCGTGCTGGTGGGATTCTCGGGG
CCCTTCGGCTTCCACAGGGTCACGCCCAGGGACCTCATGTCGTCCTTCATCGGGACTATG
GTCTGCGTCGAGGGCATCGTCACGAAATGTTCACTAGTAAGGCCGAAAGTTGTTAAGAGT
GTTCACTATTGCCCTGCTACTGGAGGTACTCTCTCACGTGAATACAGGGACATCACATCT
TTCGTAGGCCTACCTACTGGTTCGGTTTATCCAACAAGGGATGAAAATGGTAACTTGTTG
GTCACTGAGTACGGGATGTGTGAATACAAGGATCACCAAACACTCTCCATGCAAGAAGTG
CCTGAAAATTCTGCCCCTGGACAGCTCCCAAGAACAGTGGACATTATTGTAGAAGATGAC
CTAGTAGATTCTTGCAAGCCAGGTGACCGAGTATCAATTGTTGGTGTTTACAAGGCTCTT
CCAGGGAAAAGCAAGGGCAGTGTTAGTGGTGTGTTCAGGACTGTCCTTATTGCAAACAAT
GTTTCACTTATGAACAAAGAAGCAAATGCACCTGTCTATACTCGGGAGGATTTGAAGAGG
ATGAAAGAAATATCAAGGAGAAATGACACATTTGACTTACTAGGAAATTCACTTGCTCCA
TCTATATATGGCCATCTGTGGATAAAGAAAGCAGTAGTTCTATTAATGCTTGGTGGTGTA
GAGAAGAATCTGAAGAATGGAACTCACTTGAGAGGAGATATAAACATGATGATGGTAGGA
GATCCTTCAGTTGCCAAGTCCCAGCTCCTAAGAGCGGTTATGAACATTGCCCCTTTGGCT
ATTTCAACTACTGGAAGGGGTTCATCTGGTGTTGGTTTGACCGCTGCTGTCACTTCTGAT
CAAGAGACTGGTGAGAGAAGGCTGGAGGCTGGTGCCATGGTTCTTGCTGATCGTGGTGTT
GTCTGCATTGATGAGTTTGATAAGATGAATGATCAGGACCGAGTGGCTATTCATGAAGTT
ATGGAACAGCAAACTGTGACGATTGCAAAGGCAGGAATTCATGCGTCACTAAATGCGAGA
TGTAGTGTGATTGCTGCAGCAAATCCAATATATGGAACTTATGACCGTTCATTGACACCA
ACCAAGAACATTGGGCTTCCAGATTCATTACTCTCACGTTTTGATTTGCTTTTTATTGTT
CTTGATCAAATGGATCCTGAGATTGATCGTCAAATTTCTGAACATGTTGCACGGATGCAT
AGATATTGCACTGATGATGGAGGAGCAAGATCTCTTGATAAAACAGGATATGCTGAAGAA
GATGATGGTGATGTTAATGCAGCCATATTTGTTAAATATGATAGAATGCTCCATGGGCAG
GACAGAAGGAGAGGCAAGAAATCCAAACAGGACAGACTGACTGTCAAATTCCTGAAGAAA
TATATTCATTATGCAAAGAACCTTATTCAGCCAAGACTAACTGATGAGGCATCTGATCAT
ATTGCAACTTCATATGCTGAGCTCAGGGATGGTGGTGCAAATGCAAAGTCTGGTGGAGGT
ACACTTCCGATCACAGCGAGGACACTGGAAACCATAATTCGTCTATCTACTGCTCATGCC
AAGATGAAATTGAGACATGAGgttctaaaaactgacgttgaagctgcactgcaagttctg
aattttgcaatataccacaaagagttaactgagatggaagagcgtgaacagagagagatg
gaaatgaAACAACAAGCTGATCATGATGCAGGTGCAAGTGGTGGTAATGCAGATGAGCAT
AGAAGttctggaaacgacccaatggatgtggatgtaggaaatgcatcgaatgatcaggat
gttcctgcggagagaattgaagcatttgaggcgattcttggtcagcatgtgttggcaaat
catctcgatcaaatatcaattgacgaaattgagcaaactgttaatagagaggcagctgca
ccttacaatagacgtcaagtagaattcattttggagaggatgcaagatgcaaacaggata
atgatacgagatggcatcgttcggatAATCTAA

Protein

771 aa

>Os05t0476200-01 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
MDVNEEAMAAHKRAFLDFLDQDVGKGVYMQAVRDMVQNKRHRLIIGMDDLRNHSLDLARR
VIRSPAEYMQPASDAVTEVARNLDPKFLKEGQRVLVGFSGPFGFHRVTPRDLMSSFIGTM
VCVEGIVTKCSLVRPKVVKSVHYCPATGGTLSREYRDITSFVGLPTGSVYPTRDENGNLL
VTEYGMCEYKDHQTLSMQEVPENSAPGQLPRTVDIIVEDDLVDSCKPGDRVSIVGVYKAL
PGKSKGSVSGVFRTVLIANNVSLMNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAP
SIYGHLWIKKAVVLLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLA
ISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEV
MEQQTVTIAKAGIHASLNARCSVIAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIV
LDQMDPEIDRQISEHVARMHRYCTDDGGARSLDKTGYAEEDDGDVNAAIFVKYDRMLHGQ
DRRRGKKSKQDRLTVKFLKKYIHYAKNLIQPRLTDEASDHIATSYAELRDGGANAKSGGG
TLPITARTLETIIRLSTAHAKMKLRHEVLKTDVEAALQVLNFAIYHKELTEMEEREQREM
EMKQQADHDAGASGGNADEHRSSGNDPMDVDVGNASNDQDVPAERIEAFEAILGQHVLAN
HLDQISIDEIEQTVNREAAAPYNRRQVEFILERMQDANRIMIRDGIVRII*

5'UTR

chr05:23419626..23419727 (+ strand) : 102 bp

CDS

chr05:23419728..23419793 (+ strand) : 66 bp

chr05:23419881..23419993 (+ strand) : 113 bp

chr05:23420076..23420284 (+ strand) : 209 bp

chr05:23420771..23420901 (+ strand) : 131 bp

chr05:23420991..23421229 (+ strand) : 239 bp

chr05:23421309..23421545 (+ strand) : 237 bp

chr05:23421635..23421789 (+ strand) : 155 bp

chr05:23421860..23422068 (+ strand) : 209 bp

chr05:23422156..23422318 (+ strand) : 163 bp

chr05:23422410..23422615 (+ strand) : 206 bp

chr05:23422757..23422816 (+ strand) : 60 bp

chr05:23422903..23422995 (+ strand) : 93 bp

chr05:23423203..23423366 (+ strand) : 164 bp

chr05:23423867..23423935 (+ strand) : 69 bp

chr05:23424038..23424179 (+ strand) : 142 bp

chr05:23424287..23424343 (+ strand) : 57 bp

3'UTR

chr05:23424344..23424587 (+ strand) : 244 bp

FASTA

>Os05t0476200-01 class=Sequence position=chr05:23419626..23424587 (+ strand)
AAATCCGAAC CCGCCGCCAC AATCCCCCGC CCATTCCCGG CTTCCCGCTC CTCTCTCTCT CCCTCCCCTC CGGTCGCGCG
TCCCGTCTCC GGAGCAGCAG CCATGGACGT CAACGAGGAG GCAATGGCGG CGCACAAGCG CGCGTTCCTC GACTTCCTCG
ACCAGGATGT GAGTCCCTCT CGCCGTCGCT TTGCCTCCCG CCGCCGCCGC CGCCGTGTTC TCCGGATCCG TGGCTGACGC
CCGTTGCATC TGCAGGTCGG GAAGGGGGTG TACATGCAGG CCGTGCGCGA CATGGTGCAG AACAAGCGCC ACCGGCTCAT
CATCGGCATG GACGACCTCC GGAACCACAG CCTCGATCTC GCCCGCAGGT GGGTCTTCTC CCCCGCCTGT GTGCTGCCCG
TTCTTGCCTG GTCGATTGGT CTGTGATTGG ATCTGTTCTT GCGTTTGTAG GGTGATACGG AGCCCCGCGG AGTACATGCA
GCCGGCGTCG GACGCGGTGA CGGAGGTGGC GAGGAACCTG GACCCCAAGT TCTTGAAGGA AGGGCAGCGC GTGCTGGTGG
GATTCTCGGG GCCCTTCGGC TTCCACAGGG TCACGCCCAG GGACCTCATG TCGTCCTTCA TCGGGACTAT GGTCTGCGTC
GAGGGCATCG TCACGAAATG TAATTGAATC TCCCTAATTT TGGACATAAT CTAGTTTGTT CATAGATTTT CCGGTTGCAG
TTGGCTGATC TGGGTTTAAC TTGTGGTCTT TATGATTTAA GAAGTTCAAG TTAAGTTATA ATGTTCTACA GTTGATCCTG
CTGGTGGAAA AAGTATATAT CACAGTCCAG TCGGTTAGTA GTGATGGTAA AGCATAGCTA AGAATGTGAC TAGAAATTGC
GAATATTAGC TCTGGCTGAG GCAGCGAAAA ATTTAGGGAT AAGAATGTTC ACCTGTTGCT TATGCTTGAT TAAGTAATAC
TATGTGTATC TATGTTTAGT TTAGTGTTCA ACTGATCATT CAATTTAGTT GTGCATATTC CATATATTAA GTTGATAGCT
CATTAGGCCT ATCACATCAT TACTCTGTGC CTGGCTGCCT GCTACTTCAC AGTTCAGAAT CATTTAAAGA TATATTGCTA
ATGCTATTTT ACTTAAAAAA TTCAGGTTCA CTAGTAAGGC CGAAAGTTGT TAAGAGTGTT CACTATTGCC CTGCTACTGG
AGGTACTCTC TCACGTGAAT ACAGGGACAT CACATCTTTC GTAGGCCTAC CTACTGGTTC GGTTTATCCA ACAAGGGTAC
ATTCTTTTGA TCATCCTTTT GCTACTCTAT TCAATGAAAC CTATTTGTTG TTTTGTTTGT AATGCTGCTA ATTTGGAATA
CTTAGGATGA AAATGGTAAC TTGTTGGTCA CTGAGTACGG GATGTGTGAA TACAAGGATC ACCAAACACT CTCCATGCAA
GAAGTGCCTG AAAATTCTGC CCCTGGACAG CTCCCAAGAA CAGTGGACAT TATTGTAGAA GATGACCTAG TAGATTCTTG
CAAGCCAGGT GACCGAGTAT CAATTGTTGG TGTTTACAAG GCTCTTCCAG GGAAAAGCAA GGGCAGTGTT AGTGGTGTGT
TCAGGTGAGT TCTATGACCT TAAACTTTCC TGAACTAAAC TTTATTGTTT TCTGAAATCC TTTATATTAT ACAATGCCTA
TAGGACTGTC CTTATTGCAA ACAATGTTTC ACTTATGAAC AAAGAAGCAA ATGCACCTGT CTATACTCGG GAGGATTTGA
AGAGGATGAA AGAAATATCA AGGAGAAATG ACACATTTGA CTTACTAGGA AATTCACTTG CTCCATCTAT ATATGGCCAT
CTGTGGATAA AGAAAGCAGT AGTTCTATTA ATGCTTGGTG GTGTAGAGAA GAATCTGAAG AATGGAACTC ACTTGAGAGG
GTCAGTGCTG TTTCTTCGTA TCATTGCTTC TGTTGTAACT TGCTTTCAAT GATTGTAGTG TAAATATATC TTACTTATGT
GGTATGCAGA GATATAAACA TGATGATGGT AGGAGATCCT TCAGTTGCCA AGTCCCAGCT CCTAAGAGCG GTTATGAACA
TTGCCCCTTT GGCTATTTCA ACTACTGGAA GGGGTTCATC TGGTGTTGGT TTGACCGCTG CTGTCACTTC TGATCAAGAG
ACTGGTAATT ATTGAAACTT GTTTCATACA TATTTGTTTG ATTCTTATAG GTCTGAGCGA TTTCTTGTGG TTAGGTGAGA
GAAGGCTGGA GGCTGGTGCC ATGGTTCTTG CTGATCGTGG TGTTGTCTGC ATTGATGAGT TTGATAAGAT GAATGATCAG
GACCGAGTGG CTATTCATGA AGTTATGGAA CAGCAAACTG TGACGATTGC AAAGGCAGGA ATTCATGCGT CACTAAATGC
GAGATGTAGT GTGATTGCTG CAGCAAATCC AATATATGGA ACTGTAAGTT CTTATTATTT CTCGTCCGCT GCTTTTATGG
CGTGATAATG TTCTTGCATT TTCTGATAAT AATTTTTGGC TGTGTTACAG TATGACCGTT CATTGACACC AACCAAGAAC
ATTGGGCTTC CAGATTCATT ACTCTCACGT TTTGATTTGC TTTTTATTGT TCTTGATCAA ATGGATCCTG AGATTGATCG
TCAAATTTCT GAACATGTTG CACGGATGCA TAGATATTGC ACTGATGATG GAGGTATTTT TGTGTTTTAT TACAACAAAG
TGAGATATTT CAGCCTTTTC AGTTATTCTA TTTGCTTAAC TGAAAACAAA CATGTAAACT GCAGGAGCAA GATCTCTTGA
TAAAACAGGA TATGCTGAAG AAGATGATGG TGATGTTAAT GCAGCCATAT TTGTTAAATA TGATAGAATG CTCCATGGGC
AGGACAGAAG GAGAGGCAAG AAATCCAAAC AGGACAGACT GACTGTCAAA TTCCTGAAGA AATATATTCA TTATGCAAAG
AACCTTATTC AGCCAAGACT AACTGATGAG GTGATTTTCT TAAATGAGAT ATTATTCTTG TTTATCATCG CTATGTATGA
AGTGTTATGT TGATAACTTT CTTCATAGTA AAAGAAAATT TCTGTTGATA GCTTCTTCAG ATATATCATT TAAGCTTTTG
TGCTCCTACA GGCATCTGAT CATATTGCAA CTTCATATGC TGAGCTCAGG GATGGTGGTG CAAATGCAAA GGTTTGCTCT
AAGCATGGCT CCTTGTTTTT TTTTGATGTA ATGATGTTAT ATGTTTGTAA TTGTTTTCTT TTCCATTTGT TCTATAGTCT
GGTGGAGGTA CACTTCCGAT CACAGCGAGG ACACTGGAAA CCATAATTCG TCTATCTACT GCTCATGCCA AGATGAAATT
GAGACATGAG GTAATTTGCT ACATACACCA TGGGCTTGTT TAATCAAGTA ACCTGTAAGA ATTATCTAGA TGAACTGACA
TATAGTTCCC TGAAACATGA CAGAAACTTG TCCTTTCTAC TGTAGTATTA TAATTCTGGG AACAGTTTTA TCTCATTGTT
TTGAAGGATA GAAAATGCAG GGCAATCTAA TGAAGTTGCA TTTATCTTGC ATTGCAggtt ctaaaaactg acgttgaagc
tgcactgcaa gttctgaatt ttgcaatata ccacaaagag ttaactgaga tggaagagcg tgaacagaga gagatggaaa
tgaAACAACA AGCTGATCAT GATGCAGGTG CAAGTGGTGG TAATGCAGAT GAGCATAGAA GGTGAGCATA GTGCCTGTCT
TCTTAAAAAT GGTCCTTTAA AATGGAAAAG CATTTGACAC TGATTTCTGC AGTCCTATTT TTAATGTAAA GCAATGTTCT
CATAATGCAT TCTCGTTCCT TTTTTTCCTC AATAAATCTT GCTCGCTTTG ACTTTGCAAA AAAAAAAAAG AGCCACATTT
AACTGACATA ATGTTTATTT TGCACTAAAA TGCATCCTTC TCCATTGACA TAAAAGAACT GTTTGTAGCA TGAAAATGAA
AGGTCAATTT CTTTTAGAAA TGAATGGCGT GCTATGGAAA ATTGTTTGTC ACCATGCAAA CATGTAAAAA CATAGAATAA
CAACTCAACA CTCAAAACTG CAGTATTTTC TTAACTGCAA TAAGCTTATT TTCTGCAAAT TAAAATGAAT GCAGTTTTAT
TCTCCAGATT ACAATACATC GTGTTTAGCT AGTTGCTTTC AATAGTCTCA CATGTTTTTA TCCCCTTTCA ACTCCTGCca
gttctggaaa cgacccaatg gatgtggatg taggaaatgc atcgaatgat caggatgttc ctgcggagag gttactacat
gacatgacct caaattgcaa aatctgaatc tttagcttag gtttcttttt ctcagctaat tgtattcttc ctgttatgtc
atatttctgc agaattgaag catttgaggc gattcttggt cagcatgtgt tggcaaatca tctcgatcaa atatcaattg
acgaaattga gcaaactgtt aatagagagg cagctgcacc ttacaataga cgtcaagtag aattcatttt ggaggtacaa
acaagaaccg gctatgcttt cagtattgtc ccaaaattaa ctatgagatg ccacttattt ttggttcagt tgtatttagt
ttcatttcct tgttttttca gaggatgcaa gatgcaaaca ggataatgat acgagatggc atcgttcgga tAATCTAACT
TCAAAAATCA TGTCTTGCAT TGTGGACAAG CTGATTACTG TGCATCATCC TTGTCTTTTT CATCTGATAC TTAGCCAGTT
TGGCATTGCA GAATGTCTGC ATCTGCACCG GAGGTTGATG TACCCGTGTA TCTTAATTTT TAACAGCGAG ATTTATGATG
ATCATCTGTG TCTTTGTACT TTAAATTCAT GTACCGTAAC GTAACAATTC TCCTGATCTA GTGATATGTA GTCCCTGATT
TT

Locus: Os05g0476200

Loading...

Locus: Os05g0476200

Loading...