Os05t0476200-02

Locus

Os05g0476200

Description

Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

MCM3

CGSNL Gene Name

MINI-CHROMOSOME MAINTENANCE PROTEIN 3

Oryzabase Gene Symbol Synonym(s)

OsMCM3

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK099369 (DDBJ, Best hit)

Protein Evidence

NP_001105718.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: DNA replication (GO:0006260)

Biological Process: DNA-dependent DNA replication initiation (GO:0006270)

Cellular Component: nucleus (GO:0005634)

Molecular Function: nucleotide binding (GO:0000166)

Molecular Function: DNA binding (GO:0003677)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: nucleoside-triphosphatase activity (GO:0017111)

Functional domain (InterPro)

Mini-chromosome maintenance, DNA-dependent ATPase (IPR001208)

ATPase, AAA+ type, core (IPR003593)

Mini-chromosome maintenance complex protein 3 (IPR008046)

Nucleic acid-binding, OB-fold (IPR012340)

Nucleic acid-binding, OB-fold-like (IPR016027)

Mini-chromosome maintenance, conserved site (IPR018525)

Full-length cDNA

J033048C09 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0476200-02)

RiceXPro (AK099369)

Others

Oryzabase (9201)

KEGG (Os05t0476200-02)

Transcript

2629 bp

>Os05t0476200-02 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
GGCTTCCCGCTCCTCTCTCTCTCCCTCCCCTCCGGTCGCGCGTCCCGTCTCCGGAGCAGC
AGCCATGGACGTCAACGAGGAGGCAATGGCGGCGCACAAGCGCGCGTTCCTCGACTTCCT
CGACCAGGATGTCGGGAAGGGGGTGTACATGCAGGCCGTGCGCGACATGGTGCAGAACAA
GCGCCACCGGCTCATCATCGGCATGGACGACCTCCGGAACCACAGCCTCGATCTCGCCCG
CAGGGTGATACGGAGCCCCGCGGAGTACATGCAGCCGGCGTCGGACGCGGTGACGGAGGT
GGCGAGGAACCTGGACCCCAAGTTCTTGAAGGAAGGGCAGCGCGTGCTGGTGGGATTCTC
GGGGCCCTTCGGCTTCCACAGGGTCACGCCCAGGGACCTCATGTCGTCCTTCATCGGGAC
TATGGTCTGCGTCGAGGGCATCGTCACGAAATGTTCACTAGTAAGGCCGAAAGTTGTTAA
GAGTGTTCACTATTGCCCTGCTACTGGAGGTACTCTCTCACGTGAATACAGGGACATCAC
ATCTTTCGTAGGCCTACCTACTGGTTCGGTTTATCCAACAAGGGATGAAAATGGTAACTT
GTTGGTCACTGAGTACGGGATGTGTGAATACAAGGATCACCAAACACTCTCCATGCAAGA
AGTGCCTGAAAATTCTGCCCCTGGACAGCTCCCAAGAACAGTGGACATTATTGTAGAAGA
TGACCTAGTAGATTCTTGCAAGCCAGGTGACCGAGTATCAATTGTTGGTGTTTACAAGGC
TCTTCCAGGGAAAAGCAAGGGCAGTGTTAGTGGTGTGTTCAGGACTGTCCTTATTGCAAA
CAATGTTTCACTTATGAACAAAGAAGCAAATGCACCTGTCTATACTCGGGAGGATTTGAA
GAGGATGAAAGAAATATCAAGGAGAAATGACACATTTGACTTACTAGGAAATTCACTTGC
TCCATCTATATATGGCCATCTGTGGATAAAGAAAGCAGTAGTTCTATTAATGCTTGGTGG
TGTAGAGAAGAATCTGAAGAATGGAACTCACTTGAGAGGAGATATAAACATGATGATGGT
AGGAGATCCTTCAGTTGCCAAGTCCCAGCTCCTAAGAGCGGTTATGAACATTGCCCCTTT
GGCTATTTCAACTACTGGAAGGGGTTCATCTGGTGTTGGTTTGACCGCTGCTGTCACTTC
TGATCAAGAGACTGGTGAGAGAAGGCTGGAGGCTGGTGCCATGGTTCTTGCTGATCGTGG
TGTTGTCTGCATTGATGAGTTTGATAAGATGAATGATCAGGACCGAGTGGCTATTCATGA
AGTTATGGAACAGCAAACTGTGACGATTGCAAAGGCAGGAATTCATGCGTCACTAAATGC
GAGATGTAGTGTGATTGCTGCAGCAAATCCAATATATGGAACTTATGACCGTTCATTGAC
ACCAACCAAGAACATTGGGCTTCCAGATTCATTACTCTCACGTTTTGATTTGCTTTTTAT
TGTTCTTGATCAAATGGATCCTGAGATTGATCGTCAAATTTCTGAACATGTTGCACGGAT
GCATAGATATTGCACTGATGATGGAGGAGCAAGATCTCTTGATAAAACAGGATATGCTGA
AGAAGATGATGGTGATGTTAATGCAGCCATATTTGTTAAATATGATAGAATGCTCCATGG
GCAGGACAGAAGGAGAGGCAAGAAATCCAAACAGGACAGACTGACTGTCAAATTCCTGAA
GAAATATATTCATTATGCAAAGAACCTTATTCAGCCAAGACTAACTGATGAGGCATCTGA
TCATATTGCAACTTCATATGCTGAGCTCAGGGATGGTGGTGCAAATGCAAAGTCTGGTGG
AGGTACACTTCCGATCACAGCGAGGACACTGGAAACCATAATTCGTCTATCTACTGCTCA
TGCCAAGATGAAATTGAGACATGAGgttctaaaaactgacgttgaagctgcactgcaagt
tctgaattttgcaatataccacaaagagttaactgagatggaagagcgtgaacagagaga
gatggaaatgaAACAACAAGCTGATCATGATGCAGGTGCAAGTGGTGGTAATGCAGATGA
GCATAGAAGttctggaaacgacccaatggatgtggatgtaggaaatgcatcgaatgatca
ggatgttcctgcggagagaattgaagcatttgaggcgattcttggtcagcatgtgttggc
aaatcatctcgatcaaatatcaattgacgaaattgagcaaactgttaatagagaggcagc
tgcaccttacaatagacgtcaagtagaattcattttggagaggatgcaagatgcaaacag
gataatgatacgagatggcatcgttcggatAATCTAACTTCAAAAATCATGTCTTGCATT
GTGGACAAGCTGATTACTGTGCATCATCCTTGTCTTTTTCATCTGATACTTAGCCAGTTT
GGCATTGCAGAATGTCTGCATCTGCACCGGAGGTTGATGTACCCGTGTATCTTAATTTTT
AACAGCGAGATTTATGATGATCATCTGTGTCTTTGTACTTTAAATTCATGTACCGTAACG
TAACAATTCTCCTGATCTAGTGATATGTAGTCCCTGATTTTATATGGTC

CDS

2313 bp

>Os05t0476200-02 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
ATGGACGTCAACGAGGAGGCAATGGCGGCGCACAAGCGCGCGTTCCTCGACTTCCTCGAC
CAGGATGTCGGGAAGGGGGTGTACATGCAGGCCGTGCGCGACATGGTGCAGAACAAGCGC
CACCGGCTCATCATCGGCATGGACGACCTCCGGAACCACAGCCTCGATCTCGCCCGCAGG
GTGATACGGAGCCCCGCGGAGTACATGCAGCCGGCGTCGGACGCGGTGACGGAGGTGGCG
AGGAACCTGGACCCCAAGTTCTTGAAGGAAGGGCAGCGCGTGCTGGTGGGATTCTCGGGG
CCCTTCGGCTTCCACAGGGTCACGCCCAGGGACCTCATGTCGTCCTTCATCGGGACTATG
GTCTGCGTCGAGGGCATCGTCACGAAATGTTCACTAGTAAGGCCGAAAGTTGTTAAGAGT
GTTCACTATTGCCCTGCTACTGGAGGTACTCTCTCACGTGAATACAGGGACATCACATCT
TTCGTAGGCCTACCTACTGGTTCGGTTTATCCAACAAGGGATGAAAATGGTAACTTGTTG
GTCACTGAGTACGGGATGTGTGAATACAAGGATCACCAAACACTCTCCATGCAAGAAGTG
CCTGAAAATTCTGCCCCTGGACAGCTCCCAAGAACAGTGGACATTATTGTAGAAGATGAC
CTAGTAGATTCTTGCAAGCCAGGTGACCGAGTATCAATTGTTGGTGTTTACAAGGCTCTT
CCAGGGAAAAGCAAGGGCAGTGTTAGTGGTGTGTTCAGGACTGTCCTTATTGCAAACAAT
GTTTCACTTATGAACAAAGAAGCAAATGCACCTGTCTATACTCGGGAGGATTTGAAGAGG
ATGAAAGAAATATCAAGGAGAAATGACACATTTGACTTACTAGGAAATTCACTTGCTCCA
TCTATATATGGCCATCTGTGGATAAAGAAAGCAGTAGTTCTATTAATGCTTGGTGGTGTA
GAGAAGAATCTGAAGAATGGAACTCACTTGAGAGGAGATATAAACATGATGATGGTAGGA
GATCCTTCAGTTGCCAAGTCCCAGCTCCTAAGAGCGGTTATGAACATTGCCCCTTTGGCT
ATTTCAACTACTGGAAGGGGTTCATCTGGTGTTGGTTTGACCGCTGCTGTCACTTCTGAT
CAAGAGACTGGTGAGAGAAGGCTGGAGGCTGGTGCCATGGTTCTTGCTGATCGTGGTGTT
GTCTGCATTGATGAGTTTGATAAGATGAATGATCAGGACCGAGTGGCTATTCATGAAGTT
ATGGAACAGCAAACTGTGACGATTGCAAAGGCAGGAATTCATGCGTCACTAAATGCGAGA
TGTAGTGTGATTGCTGCAGCAAATCCAATATATGGAACTTATGACCGTTCATTGACACCA
ACCAAGAACATTGGGCTTCCAGATTCATTACTCTCACGTTTTGATTTGCTTTTTATTGTT
CTTGATCAAATGGATCCTGAGATTGATCGTCAAATTTCTGAACATGTTGCACGGATGCAT
AGATATTGCACTGATGATGGAGGAGCAAGATCTCTTGATAAAACAGGATATGCTGAAGAA
GATGATGGTGATGTTAATGCAGCCATATTTGTTAAATATGATAGAATGCTCCATGGGCAG
GACAGAAGGAGAGGCAAGAAATCCAAACAGGACAGACTGACTGTCAAATTCCTGAAGAAA
TATATTCATTATGCAAAGAACCTTATTCAGCCAAGACTAACTGATGAGGCATCTGATCAT
ATTGCAACTTCATATGCTGAGCTCAGGGATGGTGGTGCAAATGCAAAGTCTGGTGGAGGT
ACACTTCCGATCACAGCGAGGACACTGGAAACCATAATTCGTCTATCTACTGCTCATGCC
AAGATGAAATTGAGACATGAGgttctaaaaactgacgttgaagctgcactgcaagttctg
aattttgcaatataccacaaagagttaactgagatggaagagcgtgaacagagagagatg
gaaatgaAACAACAAGCTGATCATGATGCAGGTGCAAGTGGTGGTAATGCAGATGAGCAT
AGAAGttctggaaacgacccaatggatgtggatgtaggaaatgcatcgaatgatcaggat
gttcctgcggagagaattgaagcatttgaggcgattcttggtcagcatgtgttggcaaat
catctcgatcaaatatcaattgacgaaattgagcaaactgttaatagagaggcagctgca
ccttacaatagacgtcaagtagaattcattttggagaggatgcaagatgcaaacaggata
atgatacgagatggcatcgttcggatAATCTAA

Protein

771 aa

>Os05t0476200-02 Similar to DNA replication licensing factor MCM3 homolog (Replication origin activator) (ROA protein) (Fragment).
MDVNEEAMAAHKRAFLDFLDQDVGKGVYMQAVRDMVQNKRHRLIIGMDDLRNHSLDLARR
VIRSPAEYMQPASDAVTEVARNLDPKFLKEGQRVLVGFSGPFGFHRVTPRDLMSSFIGTM
VCVEGIVTKCSLVRPKVVKSVHYCPATGGTLSREYRDITSFVGLPTGSVYPTRDENGNLL
VTEYGMCEYKDHQTLSMQEVPENSAPGQLPRTVDIIVEDDLVDSCKPGDRVSIVGVYKAL
PGKSKGSVSGVFRTVLIANNVSLMNKEANAPVYTREDLKRMKEISRRNDTFDLLGNSLAP
SIYGHLWIKKAVVLLMLGGVEKNLKNGTHLRGDINMMMVGDPSVAKSQLLRAVMNIAPLA
ISTTGRGSSGVGLTAAVTSDQETGERRLEAGAMVLADRGVVCIDEFDKMNDQDRVAIHEV
MEQQTVTIAKAGIHASLNARCSVIAAANPIYGTYDRSLTPTKNIGLPDSLLSRFDLLFIV
LDQMDPEIDRQISEHVARMHRYCTDDGGARSLDKTGYAEEDDGDVNAAIFVKYDRMLHGQ
DRRRGKKSKQDRLTVKFLKKYIHYAKNLIQPRLTDEASDHIATSYAELRDGGANAKSGGG
TLPITARTLETIIRLSTAHAKMKLRHEVLKTDVEAALQVLNFAIYHKELTEMEEREQREM
EMKQQADHDAGASGGNADEHRSSGNDPMDVDVGNASNDQDVPAERIEAFEAILGQHVLAN
HLDQISIDEIEQTVNREAAAPYNRRQVEFILERMQDANRIMIRDGIVRII*

5'UTR

chr05:23419664..23419727 (+ strand) : 64 bp

CDS

chr05:23419728..23419793 (+ strand) : 66 bp

chr05:23419881..23419993 (+ strand) : 113 bp

chr05:23420076..23420284 (+ strand) : 209 bp

chr05:23420771..23420901 (+ strand) : 131 bp

chr05:23420991..23421229 (+ strand) : 239 bp

chr05:23421309..23421545 (+ strand) : 237 bp

chr05:23421635..23421789 (+ strand) : 155 bp

chr05:23421860..23422068 (+ strand) : 209 bp

chr05:23422156..23422318 (+ strand) : 163 bp

chr05:23422410..23422615 (+ strand) : 206 bp

chr05:23422757..23422816 (+ strand) : 60 bp

chr05:23422903..23422995 (+ strand) : 93 bp

chr05:23423203..23423366 (+ strand) : 164 bp

chr05:23423867..23423935 (+ strand) : 69 bp

chr05:23424038..23424179 (+ strand) : 142 bp

chr05:23424287..23424343 (+ strand) : 57 bp

3'UTR

chr05:23424344..23424595 (+ strand) : 252 bp

FASTA

>Os05t0476200-02 class=Sequence position=chr05:23419664..23424595 (+ strand)
GGCTTCCCGC TCCTCTCTCT CTCCCTCCCC TCCGGTCGCG CGTCCCGTCT CCGGAGCAGC AGCCATGGAC GTCAACGAGG
AGGCAATGGC GGCGCACAAG CGCGCGTTCC TCGACTTCCT CGACCAGGAT GTGAGTCCCT CTCGCCGTCG CTTTGCCTCC
CGCCGCCGCC GCCGCCGTGT TCTCCGGATC CGTGGCTGAC GCCCGTTGCA TCTGCAGGTC GGGAAGGGGG TGTACATGCA
GGCCGTGCGC GACATGGTGC AGAACAAGCG CCACCGGCTC ATCATCGGCA TGGACGACCT CCGGAACCAC AGCCTCGATC
TCGCCCGCAG GTGGGTCTTC TCCCCCGCCT GTGTGCTGCC CGTTCTTGCC TGGTCGATTG GTCTGTGATT GGATCTGTTC
TTGCGTTTGT AGGGTGATAC GGAGCCCCGC GGAGTACATG CAGCCGGCGT CGGACGCGGT GACGGAGGTG GCGAGGAACC
TGGACCCCAA GTTCTTGAAG GAAGGGCAGC GCGTGCTGGT GGGATTCTCG GGGCCCTTCG GCTTCCACAG GGTCACGCCC
AGGGACCTCA TGTCGTCCTT CATCGGGACT ATGGTCTGCG TCGAGGGCAT CGTCACGAAA TGTAATTGAA TCTCCCTAAT
TTTGGACATA ATCTAGTTTG TTCATAGATT TTCCGGTTGC AGTTGGCTGA TCTGGGTTTA ACTTGTGGTC TTTATGATTT
AAGAAGTTCA AGTTAAGTTA TAATGTTCTA CAGTTGATCC TGCTGGTGGA AAAAGTATAT ATCACAGTCC AGTCGGTTAG
TAGTGATGGT AAAGCATAGC TAAGAATGTG ACTAGAAATT GCGAATATTA GCTCTGGCTG AGGCAGCGAA AAATTTAGGG
ATAAGAATGT TCACCTGTTG CTTATGCTTG ATTAAGTAAT ACTATGTGTA TCTATGTTTA GTTTAGTGTT CAACTGATCA
TTCAATTTAG TTGTGCATAT TCCATATATT AAGTTGATAG CTCATTAGGC CTATCACATC ATTACTCTGT GCCTGGCTGC
CTGCTACTTC ACAGTTCAGA ATCATTTAAA GATATATTGC TAATGCTATT TTACTTAAAA AATTCAGGTT CACTAGTAAG
GCCGAAAGTT GTTAAGAGTG TTCACTATTG CCCTGCTACT GGAGGTACTC TCTCACGTGA ATACAGGGAC ATCACATCTT
TCGTAGGCCT ACCTACTGGT TCGGTTTATC CAACAAGGGT ACATTCTTTT GATCATCCTT TTGCTACTCT ATTCAATGAA
ACCTATTTGT TGTTTTGTTT GTAATGCTGC TAATTTGGAA TACTTAGGAT GAAAATGGTA ACTTGTTGGT CACTGAGTAC
GGGATGTGTG AATACAAGGA TCACCAAACA CTCTCCATGC AAGAAGTGCC TGAAAATTCT GCCCCTGGAC AGCTCCCAAG
AACAGTGGAC ATTATTGTAG AAGATGACCT AGTAGATTCT TGCAAGCCAG GTGACCGAGT ATCAATTGTT GGTGTTTACA
AGGCTCTTCC AGGGAAAAGC AAGGGCAGTG TTAGTGGTGT GTTCAGGTGA GTTCTATGAC CTTAAACTTT CCTGAACTAA
ACTTTATTGT TTTCTGAAAT CCTTTATATT ATACAATGCC TATAGGACTG TCCTTATTGC AAACAATGTT TCACTTATGA
ACAAAGAAGC AAATGCACCT GTCTATACTC GGGAGGATTT GAAGAGGATG AAAGAAATAT CAAGGAGAAA TGACACATTT
GACTTACTAG GAAATTCACT TGCTCCATCT ATATATGGCC ATCTGTGGAT AAAGAAAGCA GTAGTTCTAT TAATGCTTGG
TGGTGTAGAG AAGAATCTGA AGAATGGAAC TCACTTGAGA GGGTCAGTGC TGTTTCTTCG TATCATTGCT TCTGTTGTAA
CTTGCTTTCA ATGATTGTAG TGTAAATATA TCTTACTTAT GTGGTATGCA GAGATATAAA CATGATGATG GTAGGAGATC
CTTCAGTTGC CAAGTCCCAG CTCCTAAGAG CGGTTATGAA CATTGCCCCT TTGGCTATTT CAACTACTGG AAGGGGTTCA
TCTGGTGTTG GTTTGACCGC TGCTGTCACT TCTGATCAAG AGACTGGTAA TTATTGAAAC TTGTTTCATA CATATTTGTT
TGATTCTTAT AGGTCTGAGC GATTTCTTGT GGTTAGGTGA GAGAAGGCTG GAGGCTGGTG CCATGGTTCT TGCTGATCGT
GGTGTTGTCT GCATTGATGA GTTTGATAAG ATGAATGATC AGGACCGAGT GGCTATTCAT GAAGTTATGG AACAGCAAAC
TGTGACGATT GCAAAGGCAG GAATTCATGC GTCACTAAAT GCGAGATGTA GTGTGATTGC TGCAGCAAAT CCAATATATG
GAACTGTAAG TTCTTATTAT TTCTCGTCCG CTGCTTTTAT GGCGTGATAA TGTTCTTGCA TTTTCTGATA ATAATTTTTG
GCTGTGTTAC AGTATGACCG TTCATTGACA CCAACCAAGA ACATTGGGCT TCCAGATTCA TTACTCTCAC GTTTTGATTT
GCTTTTTATT GTTCTTGATC AAATGGATCC TGAGATTGAT CGTCAAATTT CTGAACATGT TGCACGGATG CATAGATATT
GCACTGATGA TGGAGGTATT TTTGTGTTTT ATTACAACAA AGTGAGATAT TTCAGCCTTT TCAGTTATTC TATTTGCTTA
ACTGAAAACA AACATGTAAA CTGCAGGAGC AAGATCTCTT GATAAAACAG GATATGCTGA AGAAGATGAT GGTGATGTTA
ATGCAGCCAT ATTTGTTAAA TATGATAGAA TGCTCCATGG GCAGGACAGA AGGAGAGGCA AGAAATCCAA ACAGGACAGA
CTGACTGTCA AATTCCTGAA GAAATATATT CATTATGCAA AGAACCTTAT TCAGCCAAGA CTAACTGATG AGGTGATTTT
CTTAAATGAG ATATTATTCT TGTTTATCAT CGCTATGTAT GAAGTGTTAT GTTGATAACT TTCTTCATAG TAAAAGAAAA
TTTCTGTTGA TAGCTTCTTC AGATATATCA TTTAAGCTTT TGTGCTCCTA CAGGCATCTG ATCATATTGC AACTTCATAT
GCTGAGCTCA GGGATGGTGG TGCAAATGCA AAGGTTTGCT CTAAGCATGG CTCCTTGTTT TTTTTTGATG TAATGATGTT
ATATGTTTGT AATTGTTTTC TTTTCCATTT GTTCTATAGT CTGGTGGAGG TACACTTCCG ATCACAGCGA GGACACTGGA
AACCATAATT CGTCTATCTA CTGCTCATGC CAAGATGAAA TTGAGACATG AGGTAATTTG CTACATACAC CATGGGCTTG
TTTAATCAAG TAACCTGTAA GAATTATCTA GATGAACTGA CATATAGTTC CCTGAAACAT GACAGAAACT TGTCCTTTCT
ACTGTAGTAT TATAATTCTG GGAACAGTTT TATCTCATTG TTTTGAAGGA TAGAAAATGC AGGGCAATCT AATGAAGTTG
CATTTATCTT GCATTGCAgg ttctaaaaac tgacgttgaa gctgcactgc aagttctgaa ttttgcaata taccacaaag
agttaactga gatggaagag cgtgaacaga gagagatgga aatgaAACAA CAAGCTGATC ATGATGCAGG TGCAAGTGGT
GGTAATGCAG ATGAGCATAG AAGGTGAGCA TAGTGCCTGT CTTCTTAAAA ATGGTCCTTT AAAATGGAAA AGCATTTGAC
ACTGATTTCT GCAGTCCTAT TTTTAATGTA AAGCAATGTT CTCATAATGC ATTCTCGTTC CTTTTTTTCC TCAATAAATC
TTGCTCGCTT TGACTTTGCA AAAAAAAAAA AGAGCCACAT TTAACTGACA TAATGTTTAT TTTGCACTAA AATGCATCCT
TCTCCATTGA CATAAAAGAA CTGTTTGTAG CATGAAAATG AAAGGTCAAT TTCTTTTAGA AATGAATGGC GTGCTATGGA
AAATTGTTTG TCACCATGCA AACATGTAAA AACATAGAAT AACAACTCAA CACTCAAAAC TGCAGTATTT TCTTAACTGC
AATAAGCTTA TTTTCTGCAA ATTAAAATGA ATGCAGTTTT ATTCTCCAGA TTACAATACA TCGTGTTTAG CTAGTTGCTT
TCAATAGTCT CACATGTTTT TATCCCCTTT CAACTCCTGC cagttctgga aacgacccaa tggatgtgga tgtaggaaat
gcatcgaatg atcaggatgt tcctgcggag aggttactac atgacatgac ctcaaattgc aaaatctgaa tctttagctt
aggtttcttt ttctcagcta attgtattct tcctgttatg tcatatttct gcagaattga agcatttgag gcgattcttg
gtcagcatgt gttggcaaat catctcgatc aaatatcaat tgacgaaatt gagcaaactg ttaatagaga ggcagctgca
ccttacaata gacgtcaagt agaattcatt ttggaggtac aaacaagaac cggctatgct ttcagtattg tcccaaaatt
aactatgaga tgccacttat ttttggttca gttgtattta gtttcatttc cttgtttttt cagaggatgc aagatgcaaa
caggataatg atacgagatg gcatcgttcg gatAATCTAA CTTCAAAAAT CATGTCTTGC ATTGTGGACA AGCTGATTAC
TGTGCATCAT CCTTGTCTTT TTCATCTGAT ACTTAGCCAG TTTGGCATTG CAGAATGTCT GCATCTGCAC CGGAGGTTGA
TGTACCCGTG TATCTTAATT TTTAACAGCG AGATTTATGA TGATCATCTG TGTCTTTGTA CTTTAAATTC ATGTACCGTA
ACGTAACAAT TCTCCTGATC TAGTGATATG TAGTCCCTGA TTTTATATGG TC

Locus: Os05g0476200

Loading...

Locus: Os05g0476200

Loading...