Os05t0477900-01

Locus

Os05g0477900

Description

Similar to nonspecific lipid-transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.4, OsLtpI.4

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.4, lipid transfer protein 1.4, type 1 non-specific lipid transfer protein 4

Transcript Evidence

AK243196 (DDBJ, Best hit)

Protein Evidence

A2Y5R8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J100040A06 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0477900-01)

Others

Oryzabase (13513)

KEGG (Os05t0477900-01)

Transcript

423 bp

>Os05t0477900-01 Similar to nonspecific lipid-transfer protein.
GCTGCTGCCGTGCCTGCCGTACGTGCAGTCGGGAGGGGCGGTGCCGGCGGCGTGCTGCGG
GGGGATCCGGAGCGTCGTGGCGGCGGCGCGCACCACGGCCGACCGCCGCGCCGCCTGCAC
CTGCCTCAAGAACGTCGCCGCCGGCGCCGCGGGCGGGCCATACATCAGCCGCGCCGCCGG
CCTGCCCGGCAGGTGCGGCGTCTCGGTGCCCTTCAAGATCAGCCCCAACGTCAACTGCAA
CGCGGTAAACTGAGGTGGAAGCAGCACTTTCGGCCCGCATGCATGTGGGCTCAGGGGAGC
CATGGCCCGTGGGCCGTGAATGAATAATCAACGTGCTTGTATGTACCATGTCGTGTACTC
AGCAGTTCACAAGTGTGCTTGTCCGATCAATCACCAAATTAAAGGACTCTTATGACTGTG
CGC

CDS

252 bp

>Os05t0477900-01 Similar to nonspecific lipid-transfer protein.
CTGCTGCCGTGCCTGCCGTACGTGCAGTCGGGAGGGGCGGTGCCGGCGGCGTGCTGCGGG
GGGATCCGGAGCGTCGTGGCGGCGGCGCGCACCACGGCCGACCGCCGCGCCGCCTGCACC
TGCCTCAAGAACGTCGCCGCCGGCGCCGCGGGCGGGCCATACATCAGCCGCGCCGCCGGC
CTGCCCGGCAGGTGCGGCGTCTCGGTGCCCTTCAAGATCAGCCCCAACGTCAACTGCAAC
GCGGTAAACTGA

Protein

84 aa

>Os05t0477900-01 Similar to nonspecific lipid-transfer protein.
LLPCLPYVQSGGAVPAACCGGIRSVVAAARTTADRRAACTCLKNVAAGAAGGPYISRAAG
LPGRCGVSVPFKISPNVNCNAVN*

5'UTR

chr05:23508215..23508215 (+ strand) : 1 bp

CDS

chr05:23508216..23508457 (+ strand) : 242 bp

chr05:23508830..23508839 (+ strand) : 10 bp

3'UTR

chr05:23508840..23509009 (+ strand) : 170 bp

FASTA

>Os05t0477900-01 class=Sequence position=chr05:23508215..23509009 (+ strand)
GCTGCTGCCG TGCCTGCCGT ACGTGCAGTC GGGAGGGGCG GTGCCGGCGG CGTGCTGCGG GGGGATCCGG AGCGTCGTGG
CGGCGGCGCG CACCACGGCC GACCGCCGCG CCGCCTGCAC CTGCCTCAAG AACGTCGCCG CCGGCGCCGC GGGCGGGCCA
TACATCAGCC GCGCCGCCGG CCTGCCCGGC AGGTGCGGCG TCTCGGTGCC CTTCAAGATC AGCCCCAACG TCAACTGCAA
CGCGTACGTG AAAACCAAAA ATCAAATTAA CCTCTACTAG TAGtactacc tccgtcccaa aataagtgta gccgtggata
ttcgtgtcca acgtttgacc gtccgtctta tttgaaaatt ttgtgaaaaa tttaaaaata tttagtcaca cgtaaagaac
tattcaagtt ttattatcta atagcaataa aaatactaat cataaaaatt ttttaaatga gacgaacggt caaacgttaa
acgtgaatag tgtaaaacta cacttatttt aggacggagg gagtaCTTAC TTTTTTTTCC CCTTCGTTTT TTGCGTGAAA
TTTGTTGGTG TTTTTGGAAC GGTTTTAACG TGTTGGTTCT GGACTTCTGG TGCAGGGTAA ACTGAGGTGG AAGCAGCACT
TTCGGCCCGC ATGCATGTGG GCTCAGGGGA GCCATGGCCC GTGGGCCGTG AATGAATAAT CAACGTGCTT GTATGTACCA
TGTCGTGTAC TCAGCAGTTC ACAAGTGTGC TTGTCCGATC AATCACCAAA TTAAAGGACT CTTATGACTG TGCGC

Locus: Os05g0477900

Loading...

Locus: Os05g0477900

Loading...