Os05t0481900-01

Locus

Os05g0481900

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS6b, PILS6b

Oryzabase Gene Name Synonym(s)

PIN likes 6b

Transcript Evidence

AK119626 (DDBJ, Best hit)

Protein Evidence

XP_002323690.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

002-117-H11 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0481900-01)

RiceXPro (AK119626)

Others

Oryzabase (19849)

KEGG (Os05t0481900-01)

Transcript

1738 bp

>Os05t0481900-01 Auxin efflux carrier domain containing protein.
CTTGCTATTTTTGGCTACAAGTTCGCCGCCCCGGGCAGCTGCTTGGCCGTCGCGACGCAG
CCGCGTCTGTTCGATCAGTTCAGCTCGCGCGGTTTTAGGTGGGGAGGAATCCTGTTCGAT
TTCGCCGGTTGCTTGTGGTTTCGTGTCGGAGGCGGGGGCGGCGATGATGGGGAGGTCGGT
GCTGGAGATGGTGGTGGCGGCGGCGCAGGGCGGCGGCGGCGCGGCGGGGGAGTCGGTGTT
GGGCATGTTCAGGTACGCCGTGCTGCCCATCGCCAAGGTGTTCGTCGTCTGCTTCATGGG
GTTCCTCATGGCGTCCAAGCGCGTCGGCGTGCTCAAGCCCAGCGGCCGCAAGCTTCTCAA
TGCGCTTGTGTTCTCTCTGCTCCTTCCTTGCCTAATATTTGCGCAGCTCGGGAGATCAAT
CACAATTGACAAGATCATGGAGTGGTGGTTCATTCCAGCAAACATTGCTCTGGGTGCAGT
CTCTGCATCTTTGGTTGGACTTATAGTGGCATTGATTGTACGGCCGCCTTATCCATACTT
CAAGTTCACCATCACTCACATTGGAATAGGGAACATTGGAAATATACCACTTGTCCTTAT
CTCGGCATTATGTCGCGACCAATTAAATCCGTTTGGTGACTCGAACAAATGTACTCAAGA
TGGAAATGCATACTTATCATTTGGTCAATGGGTTGGTGCCATTATTGTTTACACATATGT
GTTCAAGATGCTTGCTCCACCCCCCGGGCAGACCTTTGACAGCTGCGATGAGGAGAGAGA
TAAACTTCCAATTAAGGCTCCTAATACCATGTCAAGTGTAGCGAAATATCCATCAAGTGC
TCATGGCAATACACATGAGGAAGAGCCCCTGCTATCTATAGAGGAGGAGGAGGAGGAGGA
GGGGCAGGACGTTCATTCTTTAGGTTCAAAAATAATGATTCCTATCAAGGGCATGGTTAG
ATTCCTACAAAAGAAGCAGCTCCTCCAACCACCAATCATTGCATCTGTTCTTGCAATTAC
TCTCGGTGTTGTGCCATTCTTGAAGAATTTGATCCTCACAGATGACGCGCCTCTATTCTT
TTTAACAGATAGCTGTCTCATTCTTGGGGAAGCTATGATTCCGTGCATTTTGCTTGCCGT
TGGTGGCAATCTTGTTGACGGCCCTGGTGAAGGAAGTAGGAGACTTGGGGTTCGGACCAC
CGTCGCGATTATATTTGCACGCTTGATATTGGTTCCAATTGCTGGTATTGGCATCGTCTC
ATTTGCTGACAAGCTTGGATTTATTCCAAAAGGAGACAAGATGTTCAAGTTCGTCCTGTT
ACTGCAGCACTCTATGCCCACATCGGTACTATCAGGTGCTGTTGCAAACCTAAGAGGTTG
TGGCAAGGAATCAGCTGCAATCTTGTTCTGGGTGCACATTTTTGCTGTCTTCTCCATGGC
AGGATGGATTATCTTATATCTTACCATGCTGTTCTAGATACTAACTGCACTATGACATAA
TATGATATGTTCATGAAATACATGTTGCTGCAAAGTGCAAGGTGATTGGAAGTGCGACCC
TGTTGGATCTGCGGGTTGCATTTTCCGGGCCGTGGACAATTGCGAGAGGCCTGCTATTGT
ATGTTTTGTTTGGTTAGCTGCTGAAAACAATAGATGAGGCAAAGGAATTGTGTCAGCACC
TCTTGTACATTTGATCGTAAAATACAGGATATCTCCAACTAATAGAGAGCCTTGTATC

CDS

1314 bp

>Os05t0481900-01 Auxin efflux carrier domain containing protein.
ATGATGGGGAGGTCGGTGCTGGAGATGGTGGTGGCGGCGGCGCAGGGCGGCGGCGGCGCG
GCGGGGGAGTCGGTGTTGGGCATGTTCAGGTACGCCGTGCTGCCCATCGCCAAGGTGTTC
GTCGTCTGCTTCATGGGGTTCCTCATGGCGTCCAAGCGCGTCGGCGTGCTCAAGCCCAGC
GGCCGCAAGCTTCTCAATGCGCTTGTGTTCTCTCTGCTCCTTCCTTGCCTAATATTTGCG
CAGCTCGGGAGATCAATCACAATTGACAAGATCATGGAGTGGTGGTTCATTCCAGCAAAC
ATTGCTCTGGGTGCAGTCTCTGCATCTTTGGTTGGACTTATAGTGGCATTGATTGTACGG
CCGCCTTATCCATACTTCAAGTTCACCATCACTCACATTGGAATAGGGAACATTGGAAAT
ATACCACTTGTCCTTATCTCGGCATTATGTCGCGACCAATTAAATCCGTTTGGTGACTCG
AACAAATGTACTCAAGATGGAAATGCATACTTATCATTTGGTCAATGGGTTGGTGCCATT
ATTGTTTACACATATGTGTTCAAGATGCTTGCTCCACCCCCCGGGCAGACCTTTGACAGC
TGCGATGAGGAGAGAGATAAACTTCCAATTAAGGCTCCTAATACCATGTCAAGTGTAGCG
AAATATCCATCAAGTGCTCATGGCAATACACATGAGGAAGAGCCCCTGCTATCTATAGAG
GAGGAGGAGGAGGAGGAGGGGCAGGACGTTCATTCTTTAGGTTCAAAAATAATGATTCCT
ATCAAGGGCATGGTTAGATTCCTACAAAAGAAGCAGCTCCTCCAACCACCAATCATTGCA
TCTGTTCTTGCAATTACTCTCGGTGTTGTGCCATTCTTGAAGAATTTGATCCTCACAGAT
GACGCGCCTCTATTCTTTTTAACAGATAGCTGTCTCATTCTTGGGGAAGCTATGATTCCG
TGCATTTTGCTTGCCGTTGGTGGCAATCTTGTTGACGGCCCTGGTGAAGGAAGTAGGAGA
CTTGGGGTTCGGACCACCGTCGCGATTATATTTGCACGCTTGATATTGGTTCCAATTGCT
GGTATTGGCATCGTCTCATTTGCTGACAAGCTTGGATTTATTCCAAAAGGAGACAAGATG
TTCAAGTTCGTCCTGTTACTGCAGCACTCTATGCCCACATCGGTACTATCAGGTGCTGTT
GCAAACCTAAGAGGTTGTGGCAAGGAATCAGCTGCAATCTTGTTCTGGGTGCACATTTTT
GCTGTCTTCTCCATGGCAGGATGGATTATCTTATATCTTACCATGCTGTTCTAG

Protein

438 aa

>Os05t0481900-01 Auxin efflux carrier domain containing protein.
MMGRSVLEMVVAAAQGGGGAAGESVLGMFRYAVLPIAKVFVVCFMGFLMASKRVGVLKPS
GRKLLNALVFSLLLPCLIFAQLGRSITIDKIMEWWFIPANIALGAVSASLVGLIVALIVR
PPYPYFKFTITHIGIGNIGNIPLVLISALCRDQLNPFGDSNKCTQDGNAYLSFGQWVGAI
IVYTYVFKMLAPPPGQTFDSCDEERDKLPIKAPNTMSSVAKYPSSAHGNTHEEEPLLSIE
EEEEEEGQDVHSLGSKIMIPIKGMVRFLQKKQLLQPPIIASVLAITLGVVPFLKNLILTD
DAPLFFLTDSCLILGEAMIPCILLAVGGNLVDGPGEGSRRLGVRTTVAIIFARLILVPIA
GIGIVSFADKLGFIPKGDKMFKFVLLLQHSMPTSVLSGAVANLRGCGKESAAILFWVHIF
AVFSMAGWIILYLTMLF*

5'UTR

chr05:23700508..23700670 (- strand) : 163 bp

CDS

chr05:23700307..23700507 (- strand) : 201 bp

chr05:23700073..23700152 (- strand) : 80 bp

chr05:23699825..23699949 (- strand) : 125 bp

chr05:23699612..23699733 (- strand) : 122 bp

chr05:23699276..23699515 (- strand) : 240 bp

chr05:23699087..23699161 (- strand) : 75 bp

chr05:23698885..23698985 (- strand) : 101 bp

chr05:23698709..23698761 (- strand) : 53 bp

chr05:23698383..23698577 (- strand) : 195 bp

chr05:23698158..23698279 (- strand) : 122 bp

3'UTR

chr05:23697744..23698004 (- strand) : 261 bp

FASTA

>Os05t0481900-01 class=Sequence position=chr05:23697744..23700670 (- strand)
CTTGCTATTT TTGGCTACAA GTTCGCCGCC CCGGGCAGCT GCTTGGCCGT CGCGACGCAG CCGCGTCTGT TCGATCAGTT
CAGCTCGCGC GGTTTTAGGT GGGGAGGAAT CCTGTTCGAT TTCGCCGGTT GCTTGTGGTT TCGTGTCGGA GGCGGGGGCG
GCGATGATGG GGAGGTCGGT GCTGGAGATG GTGGTGGCGG CGGCGCAGGG CGGCGGCGGC GCGGCGGGGG AGTCGGTGTT
GGGCATGTTC AGGTACGCCG TGCTGCCCAT CGCCAAGGTG TTCGTCGTCT GCTTCATGGG GTTCCTCATG GCGTCCAAGC
GCGTCGGCGT GCTCAAGCCC AGCGGCCGCA AGCTTCTCAA TGCGGTAAGG CGCCTAATTC AGTAGTTCTC ACAACCATCA
TGGTGGCTCG CTAATTTTCA GAATATAATG GAATTCAGAC TAGCTATGGG AACATCAGCA GAATTCAGGC TAGCTATGTT
GATTTATCTT GTCTTTTTTT TTTTTGTTAT TTTTGCAGCT TGTGTTCTCT CTGCTCCTTC CTTGCCTAAT ATTTGCGCAG
CTCGGGAGAT CAATCACAAT TGACAAGATC ATGGAGTGGT AAGAAAGAAC ATATTAGTAC TCATTTAGAT GATTAGCCAC
AAGTTGTATC TTTCCCTTGG CGATATTTGG GGTCTTCTTG TGTCAAAGCA TTTCAACATT ACTCATGATG TTGCATTGCA
GGTGGTTCAT TCCAGCAAAC ATTGCTCTGG GTGCAGTCTC TGCATCTTTG GTTGGACTTA TAGTGGCATT GATTGTACGG
CCGCCTTATC CATACTTCAA GTTCACCATC ACTCACATTG GAATAGGTTT GTACATTCCT CACGCCCTTA TGAATATCGC
TAGCTTCTGA TTCATCACGC ATTCTGCATT ATATTTTTAA CATTTCACTT AATGCAGGGA ACATTGGAAA TATACCACTT
GTCCTTATCT CGGCATTATG TCGCGACCAA TTAAATCCGT TTGGTGACTC GAACAAATGT ACTCAAGATG GAAATGCATA
CTTATCATTT GGTCAATGGG TATGTCCAAA TCCGTTTGTT TATGGAGTTG CACATCCCTT TTTAAAATGC TACTCCAAAT
ACTTATCATA TCTATTGGAT TGTTTACCGG TGCAGGTTGG TGCCATTATT GTTTACACAT ATGTGTTCAA GATGCTTGCT
CCACCCCCCG GGCAGACCTT TGACAGCTGC GATGAGGAGA GAGATAAACT TCCAATTAAG GCTCCTAATA CCATGTCAAG
TGTAGCGAAA TATCCATCAA GTGCTCATGG CAATACACAT GAGGAAGAGC CCCTGCTATC TATAGAGGAG GAGGAGGAGG
AGGAGGGGCA GGACGTTCAT TCTTTAGGTT CAAAAGTAAG AAGTGGGCAC AACATAATGC TAGTTCAGCA TATTGGAAAA
AAAAAATAGA GGCACTTCAG TAGTTGTTAC CAAAATAACT AATAATACTC CATTTATGGC TTAATGCAGA TAATGATTCC
TATCAAGGGC ATGGTTAGAT TCCTACAAAA GAAGCAGCTC CTCCAACCAC CAATCATTGC ATCTGTAAGT GCTCGGTATA
TTTGGTTTTT GTCTCTTATC ACTGCCGTAA AACAATACTT GCATTTTTCT CAATTATCTG AATGTTCCTT TGCGTCATGT
AACAGGTTCT TGCAATTACT CTCGGTGTTG TGCCATTCTT GAAGAATTTG ATCCTCACAG ATGACGCGCC TCTATTCTTT
TTAACAGATA GCTGTCTCAT TCTTGGGTAT TGACCTGTCT CATGACTTGT AGTTTCTTCT TGCAATATGC CTATAGTGTC
TTGTAATAAC AAATATGATT CGCATTTAAA AACCATCTCT TGCTAACAAT GCTGTTTTAT ATATTTCAGG GAAGCTATGA
TTCCGTGCAT TTTGCTTGCC GTTGGTGGCA ATCTTGTTGA CGGTAAGCTC ATCTTGTATT CTCAAATCTC ATTAGAACCG
TGCTGCAATA TGAAGTGTGC TTTTAGTACA TTTATACTTC TGCAATTTAT ATGTTTATCT GAAGTCCATA CTTGTGGTTT
ATTATGGTTT TAGGCCCTGG TGAAGGAAGT AGGAGACTTG GGGTTCGGAC CACCGTCGCG ATTATATTTG CACGCTTGAT
ATTGGTTCCA ATTGCTGGTA TTGGCATCGT CTCATTTGCT GACAAGCTTG GATTTATTCC AAAAGGAGAC AAGATGTTCA
AGTTCGTCCT GTTACTGCAG CACTCTATGC CCACATCGGT ACTATCAGGT ACGAAAAAGT ATAAGGATGA CTGAGACATC
ATATTTGGCA TGTTAATCAA CCTTTGAGTA TAATACAGTT GCAATACTAA TCTGCTATTT TTTATGGGCA GGTGCTGTTG
CAAACCTAAG AGGTTGTGGC AAGGAATCAG CTGCAATCTT GTTCTGGGTG CACATTTTTG CTGTCTTCTC CATGGCAGGA
TGGATTATCT TATATCTTAC CATGCTGTTC TAGGTATTTG ATTTTGAGCC CCCTCTGGGT GTGTGTGCCT GAATATGATG
CTCCTCCTGG GTTAGCTGCT GTCGGCAGTA CTGTGTCTGG TTGTACATTT TTCCGCTGTC CCTCGAGTTA TTGTAGTTTA
TAATGTTTCA TCTGATTCTT TTGTAGATAC TAACTGCACT ATGACATAAT ATGATATGTT CATGAAATAC ATGTTGCTGC
AAAGTGCAAG GTGATTGGAA GTGCGACCCT GTTGGATCTG CGGGTTGCAT TTTCCGGGCC GTGGACAATT GCGAGAGGCC
TGCTATTGTA TGTTTTGTTT GGTTAGCTGC TGAAAACAAT AGATGAGGCA AAGGAATTGT GTCAGCACCT CTTGTACATT
TGATCGTAAA ATACAGGATA TCTCCAACTA ATAGAGAGCC TTGTATC

Locus: Os05g0481900

Loading...

Locus: Os05g0481900

Loading...