Os05t0481900-02

Locus

Os05g0481900

Description

Auxin efflux carrier domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPILS6b, PILS6b

Oryzabase Gene Name Synonym(s)

PIN likes 6b

Transcript Evidence

AK106744 (DDBJ, Best hit)

Protein Evidence

XP_002323690.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Auxin efflux carrier (IPR004776)

Full-length cDNA

002-115-B08 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0481900-02)

Others

Oryzabase (19849)

Transcript

1705 bp

>Os05t0481900-02 Auxin efflux carrier domain containing protein.
AGCTGCTTGGCCGTCGCGACGCAGCCGCGTCTGTTCGATCAGTTCAGCTCGCGCGGTTTT
AGGTGGGGAGGAATCCTGTTCGATTTCGCCGGTTGCTTGTGGTTTCGTGTCGGAGGCGGG
GGCGGCGATGATGGGGAGGTCGGTGCTGGAGATGGTGGTGGCGGCGGCGCAGGGCGGCGG
CGGCGCGGCGGGGGAGTCGGTGTTGGGCATGTTCAGGTACGCCGTGCTGCCCATCGCCAA
GGTGTTCGTCGTCTGCTTCATGGGGTTCCTCATGGCGTCCAAGCGCGTCGGCGTGCTCAA
GCCCAGCGGCCGCAAGCTTCTCAATGCGCTTGTGTTCTCTCTGCTCCTTCCTTGCCTAAT
ATTTGCGCAGCTCGGGAGATCAATCACAATTGACAAGATCATGGAGTGGTGGTTCATTCC
AGCAAACATTGCTCTGGGTGCAGTCTCTGCATCTTTGGTTGGACTTATAGTGGCATTGAT
TGTACGGCCGCCTTATCCATACTTCAAGTTCACCATCACTCACATTGGAATAGGGAACAT
TGGAAATATACCACTTGTCCTTATCTCGGCATTATGTCGCGACCAATTAAATCCGTTTGG
TGACTCGAACAAATGTACTCAAGATGGAAATGCATACTTATCATTTGGTCAATGGGTTGG
TGCCATTATTGTTTACACATATGTGTTCAAGATGCTTGCTCCACCCCCCGGGCAGACCTT
TGACAGCTGCGATGAGGAGAGAGATAAACTTCCAATTAAGGCTCCTAATACCATGTCAAG
TGTAGCGAAATATCCATCAAGTGCTCATGGCAATACACATGAGGAAGAGCCCCTGCTATC
TATAGAGGAGGAGGAGGAGGAGGAGGGGCAGGACGTTCATTCTTTAGGTTCAAAAATAAT
GATTCCTATCAAGGGCATGGTTAGATTCCTACAAAAGAAGCAGCTCCTCCAACCACCAAT
CATTGCATCTGTTCTTGCAATTACTCTCGGTGTTGTGCCATTCTTGAAGAATTTGATCCT
CACAGATGACGCGCCTCTATTCTTTTTAACAGATAGCTGTCTCATTCTTGGGGAAGCTAT
GATTCCGTGCATTTTGCTTGCCGTTGGTGGCAATCTTGTTGACGGCCCTGGTGAAGGAAG
TAGGAGACTTGGGGTTCGGACCACCGTCGCGATTATATTTGCACGCTTGATATTGGTTCC
AATTGCTGGTATTGGCATCGTCTCATTTGCTGACAAGCTTGGATTTATTCCAAAAGGAGA
CAAGATGTTCAAGTTCGTCCTGTTACTGCAGCACTCTATGCCCACATCGGTACTATCAGG
TGCTGTTGCAAACCTAAGAGGTTGTGGCAAGGAATCAGCTGCAATCTTGTTCTGGGTGCA
CATTTTTGCTGTCTTCTCCATGGCAGGATGGATTATCTTATATCTTACCATGCTGTTCTA
GATACTAACTGCACTATGACATAATATGATATGTTCATGAAATACATGTTGCTGCAAAGT
GCAAGGTGATTGGAAGTGCGACCCTGTTGGATCTGCGGGTTGCATTTTCCGGGCCGTGGA
CAATTGCGAGAGGCCTGCTATTGTATGTTTTGTTTGGTTAGCTGCTGAAAACAATAGATG
AGGCAAAGGAATTGTGTCAGCACCTCTTGTACATTTGATCGTAAAATACAGGATATCTCC
AACTAATAGAGAGCCTTGTATCCCC

CDS

1314 bp

>Os05t0481900-02 Auxin efflux carrier domain containing protein.
ATGATGGGGAGGTCGGTGCTGGAGATGGTGGTGGCGGCGGCGCAGGGCGGCGGCGGCGCG
GCGGGGGAGTCGGTGTTGGGCATGTTCAGGTACGCCGTGCTGCCCATCGCCAAGGTGTTC
GTCGTCTGCTTCATGGGGTTCCTCATGGCGTCCAAGCGCGTCGGCGTGCTCAAGCCCAGC
GGCCGCAAGCTTCTCAATGCGCTTGTGTTCTCTCTGCTCCTTCCTTGCCTAATATTTGCG
CAGCTCGGGAGATCAATCACAATTGACAAGATCATGGAGTGGTGGTTCATTCCAGCAAAC
ATTGCTCTGGGTGCAGTCTCTGCATCTTTGGTTGGACTTATAGTGGCATTGATTGTACGG
CCGCCTTATCCATACTTCAAGTTCACCATCACTCACATTGGAATAGGGAACATTGGAAAT
ATACCACTTGTCCTTATCTCGGCATTATGTCGCGACCAATTAAATCCGTTTGGTGACTCG
AACAAATGTACTCAAGATGGAAATGCATACTTATCATTTGGTCAATGGGTTGGTGCCATT
ATTGTTTACACATATGTGTTCAAGATGCTTGCTCCACCCCCCGGGCAGACCTTTGACAGC
TGCGATGAGGAGAGAGATAAACTTCCAATTAAGGCTCCTAATACCATGTCAAGTGTAGCG
AAATATCCATCAAGTGCTCATGGCAATACACATGAGGAAGAGCCCCTGCTATCTATAGAG
GAGGAGGAGGAGGAGGAGGGGCAGGACGTTCATTCTTTAGGTTCAAAAATAATGATTCCT
ATCAAGGGCATGGTTAGATTCCTACAAAAGAAGCAGCTCCTCCAACCACCAATCATTGCA
TCTGTTCTTGCAATTACTCTCGGTGTTGTGCCATTCTTGAAGAATTTGATCCTCACAGAT
GACGCGCCTCTATTCTTTTTAACAGATAGCTGTCTCATTCTTGGGGAAGCTATGATTCCG
TGCATTTTGCTTGCCGTTGGTGGCAATCTTGTTGACGGCCCTGGTGAAGGAAGTAGGAGA
CTTGGGGTTCGGACCACCGTCGCGATTATATTTGCACGCTTGATATTGGTTCCAATTGCT
GGTATTGGCATCGTCTCATTTGCTGACAAGCTTGGATTTATTCCAAAAGGAGACAAGATG
TTCAAGTTCGTCCTGTTACTGCAGCACTCTATGCCCACATCGGTACTATCAGGTGCTGTT
GCAAACCTAAGAGGTTGTGGCAAGGAATCAGCTGCAATCTTGTTCTGGGTGCACATTTTT
GCTGTCTTCTCCATGGCAGGATGGATTATCTTATATCTTACCATGCTGTTCTAG

Protein

438 aa

>Os05t0481900-02 Auxin efflux carrier domain containing protein.
MMGRSVLEMVVAAAQGGGGAAGESVLGMFRYAVLPIAKVFVVCFMGFLMASKRVGVLKPS
GRKLLNALVFSLLLPCLIFAQLGRSITIDKIMEWWFIPANIALGAVSASLVGLIVALIVR
PPYPYFKFTITHIGIGNIGNIPLVLISALCRDQLNPFGDSNKCTQDGNAYLSFGQWVGAI
IVYTYVFKMLAPPPGQTFDSCDEERDKLPIKAPNTMSSVAKYPSSAHGNTHEEEPLLSIE
EEEEEEGQDVHSLGSKIMIPIKGMVRFLQKKQLLQPPIIASVLAITLGVVPFLKNLILTD
DAPLFFLTDSCLILGEAMIPCILLAVGGNLVDGPGEGSRRLGVRTTVAIIFARLILVPIA
GIGIVSFADKLGFIPKGDKMFKFVLLLQHSMPTSVLSGAVANLRGCGKESAAILFWVHIF
AVFSMAGWIILYLTMLF*

5'UTR

chr05:23700508..23700634 (- strand) : 127 bp

CDS

chr05:23700307..23700507 (- strand) : 201 bp

chr05:23700073..23700152 (- strand) : 80 bp

chr05:23699825..23699949 (- strand) : 125 bp

chr05:23699612..23699733 (- strand) : 122 bp

chr05:23699276..23699515 (- strand) : 240 bp

chr05:23699087..23699161 (- strand) : 75 bp

chr05:23698885..23698985 (- strand) : 101 bp

chr05:23698709..23698761 (- strand) : 53 bp

chr05:23698383..23698577 (- strand) : 195 bp

chr05:23698158..23698279 (- strand) : 122 bp

3'UTR

chr05:23697741..23698004 (- strand) : 264 bp

FASTA

>Os05t0481900-02 class=Sequence position=chr05:23697741..23700634 (- strand)
AGCTGCTTGG CCGTCGCGAC GCAGCCGCGT CTGTTCGATC AGTTCAGCTC GCGCGGTTTT AGGTGGGGAG GAATCCTGTT
CGATTTCGCC GGTTGCTTGT GGTTTCGTGT CGGAGGCGGG GGCGGCGATG ATGGGGAGGT CGGTGCTGGA GATGGTGGTG
GCGGCGGCGC AGGGCGGCGG CGGCGCGGCG GGGGAGTCGG TGTTGGGCAT GTTCAGGTAC GCCGTGCTGC CCATCGCCAA
GGTGTTCGTC GTCTGCTTCA TGGGGTTCCT CATGGCGTCC AAGCGCGTCG GCGTGCTCAA GCCCAGCGGC CGCAAGCTTC
TCAATGCGGT AAGGCGCCTA ATTCAGTAGT TCTCACAACC ATCATGGTGG CTCGCTAATT TTCAGAATAT AATGGAATTC
AGACTAGCTA TGGGAACATC AGCAGAATTC AGGCTAGCTA TGTTGATTTA TCTTGTCTTT TTTTTTTTTG TTATTTTTGC
AGCTTGTGTT CTCTCTGCTC CTTCCTTGCC TAATATTTGC GCAGCTCGGG AGATCAATCA CAATTGACAA GATCATGGAG
TGGTAAGAAA GAACATATTA GTACTCATTT AGATGATTAG CCACAAGTTG TATCTTTCCC TTGGCGATAT TTGGGGTCTT
CTTGTGTCAA AGCATTTCAA CATTACTCAT GATGTTGCAT TGCAGGTGGT TCATTCCAGC AAACATTGCT CTGGGTGCAG
TCTCTGCATC TTTGGTTGGA CTTATAGTGG CATTGATTGT ACGGCCGCCT TATCCATACT TCAAGTTCAC CATCACTCAC
ATTGGAATAG GTTTGTACAT TCCTCACGCC CTTATGAATA TCGCTAGCTT CTGATTCATC ACGCATTCTG CATTATATTT
TTAACATTTC ACTTAATGCA GGGAACATTG GAAATATACC ACTTGTCCTT ATCTCGGCAT TATGTCGCGA CCAATTAAAT
CCGTTTGGTG ACTCGAACAA ATGTACTCAA GATGGAAATG CATACTTATC ATTTGGTCAA TGGGTATGTC CAAATCCGTT
TGTTTATGGA GTTGCACATC CCTTTTTAAA ATGCTACTCC AAATACTTAT CATATCTATT GGATTGTTTA CCGGTGCAGG
TTGGTGCCAT TATTGTTTAC ACATATGTGT TCAAGATGCT TGCTCCACCC CCCGGGCAGA CCTTTGACAG CTGCGATGAG
GAGAGAGATA AACTTCCAAT TAAGGCTCCT AATACCATGT CAAGTGTAGC GAAATATCCA TCAAGTGCTC ATGGCAATAC
ACATGAGGAA GAGCCCCTGC TATCTATAGA GGAGGAGGAG GAGGAGGAGG GGCAGGACGT TCATTCTTTA GGTTCAAAAG
TAAGAAGTGG GCACAACATA ATGCTAGTTC AGCATATTGG AAAAAAAAAA TAGAGGCACT TCAGTAGTTG TTACCAAAAT
AACTAATAAT ACTCCATTTA TGGCTTAATG CAGATAATGA TTCCTATCAA GGGCATGGTT AGATTCCTAC AAAAGAAGCA
GCTCCTCCAA CCACCAATCA TTGCATCTGT AAGTGCTCGG TATATTTGGT TTTTGTCTCT TATCACTGCC GTAAAACAAT
ACTTGCATTT TTCTCAATTA TCTGAATGTT CCTTTGCGTC ATGTAACAGG TTCTTGCAAT TACTCTCGGT GTTGTGCCAT
TCTTGAAGAA TTTGATCCTC ACAGATGACG CGCCTCTATT CTTTTTAACA GATAGCTGTC TCATTCTTGG GTATTGACCT
GTCTCATGAC TTGTAGTTTC TTCTTGCAAT ATGCCTATAG TGTCTTGTAA TAACAAATAT GATTCGCATT TAAAAACCAT
CTCTTGCTAA CAATGCTGTT TTATATATTT CAGGGAAGCT ATGATTCCGT GCATTTTGCT TGCCGTTGGT GGCAATCTTG
TTGACGGTAA GCTCATCTTG TATTCTCAAA TCTCATTAGA ACCGTGCTGC AATATGAAGT GTGCTTTTAG TACATTTATA
CTTCTGCAAT TTATATGTTT ATCTGAAGTC CATACTTGTG GTTTATTATG GTTTTAGGCC CTGGTGAAGG AAGTAGGAGA
CTTGGGGTTC GGACCACCGT CGCGATTATA TTTGCACGCT TGATATTGGT TCCAATTGCT GGTATTGGCA TCGTCTCATT
TGCTGACAAG CTTGGATTTA TTCCAAAAGG AGACAAGATG TTCAAGTTCG TCCTGTTACT GCAGCACTCT ATGCCCACAT
CGGTACTATC AGGTACGAAA AAGTATAAGG ATGACTGAGA CATCATATTT GGCATGTTAA TCAACCTTTG AGTATAATAC
AGTTGCAATA CTAATCTGCT ATTTTTTATG GGCAGGTGCT GTTGCAAACC TAAGAGGTTG TGGCAAGGAA TCAGCTGCAA
TCTTGTTCTG GGTGCACATT TTTGCTGTCT TCTCCATGGC AGGATGGATT ATCTTATATC TTACCATGCT GTTCTAGGTA
TTTGATTTTG AGCCCCCTCT GGGTGTGTGT GCCTGAATAT GATGCTCCTC CTGGGTTAGC TGCTGTCGGC AGTACTGTGT
CTGGTTGTAC ATTTTTCCGC TGTCCCTCGA GTTATTGTAG TTTATAATGT TTCATCTGAT TCTTTTGTAG ATACTAACTG
CACTATGACA TAATATGATA TGTTCATGAA ATACATGTTG CTGCAAAGTG CAAGGTGATT GGAAGTGCGA CCCTGTTGGA
TCTGCGGGTT GCATTTTCCG GGCCGTGGAC AATTGCGAGA GGCCTGCTAT TGTATGTTTT GTTTGGTTAG CTGCTGAAAA
CAATAGATGA GGCAAAGGAA TTGTGTCAGC ACCTCTTGTA CATTTGATCG TAAAATACAG GATATCTCCA ACTAATAGAG
AGCCTTGTAT CCCC

Locus: Os05g0481900

Loading...

Locus: Os05g0481900

Loading...