Os05t0498300-01

Locus

Os05g0498300

Description

Rice homolog of MSH5, Meiosis-specific member of the MutS-homolog family, Control of class I crossover formation

RAP-DB Gene Symbol Synonym(s)

OsMSH5

RAP-DB Gene Name Synonym(s)

MutS-homolog 5

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsMSH5, MSH5

Oryzabase Gene Name Synonym(s)

MutS-homolog 5

Transcript Evidence

AK101127

Protein Evidence

Q6L4V0

Literature

PMID: 23220939

Note

Manual Curation

November 19, 2020

Gene Ontology (GO)

Biological Process: mismatch repair (GO:0006298)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: mismatched DNA binding (GO:0030983)

Functional domain (InterPro)

DNA mismatch repair protein MutS, core domain superfamily (IPR036187)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

DNA mismatch repair protein MutS/MSH (IPR017261)

DNA mismatch repair protein MutS, core (IPR007696)

DNA mismatch repair protein MutS, C-terminal (IPR000432)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

chromosome (GO:0005694) [early meiotic prophase I]

Full-length cDNA

J033025O14 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0498300-01)

RiceXPro (AK101127)

Others

Oryzabase (12251)

KEGG (Os05t0498300-01)

Transcript

2956 bp

>Os05t0498300-01 Rice homolog of MSH5, Meiosis-specific member of the MutS-homolog family, Control of class I crossover formation
AACAACTTCCTTCCCGTACAAGCCAGTGCCCGAGCCACGCTCCCGCCGCACTTCGCCCCT
CGCCGCCTAGCTTGCTCCATCCTCCGCGCCCGCGCAGCTGCGCTCGCCGTCGCCGTCGCT
GCCTAGCTTCCTCCAGCCTCCGCATCTGCGCTCTATTTGTACCGCATTCTCGGAGGAGGA
GCAGGAGGCGAGGAGCCGCCGAGTAGAGGAGAGGGGGAGGCGAAGTCGGTGCTCTCGCCG
GGGGTTGACGGTGGAACTCCGGGCGAGCGATCGAGCCGGCGAAATGGACGAGGAAGAGGA
GGAGGAGATGTCCGAGAGGGAGGTCGACTCCCAGGTTCATATGGCTTGTGTAATGCAAGG
ACGCAGAGTTGGAATAGCATACTATGATTCAAGTATGCACCAGCTTTTTGTATTGGAAAT
CTGGGAAGACATAACTGAAGATTTTCCTTTGATTGATCTTGTGAAATATCAATCCAAACC
GAGCACAATATACACAAGTACTAAAACAGATGAGGCACTTTTGTTGGCGTTACAACGAAA
TGATTGTAATGATGAGGCCCCTGCTGTGAAGCTCATGAAAAGCTCAACCTTCAGCTATGA
GCAAGCCTGGCACAGATTAATGTACTTGAAAGTCGCAGCTATGGACGAAGGGTTAAGTGT
AAAAGAAAGGATCTGTTTTCTTAATTCCATGATGGATCTTGGAAGTGACGTTCAAGTTCG
TGCTGCTGGAGGTCTTCTTGCTATATTAGACAACGAGAGGCTTCTTGATACCCTTGATCA
GATGGAAGGTGGAGCATCCATTGCTATTGATTCTGTGGCACAGATATCATTGGACAAGTT
CCTGAAACTTGATGCAACAGCTCACGAGGCGCTACAGATTTTTCAAGTAGATAAACACCC
CAGTTACATGGGAATTGGAAGGGCTAAAGAAGGGTTCTCAGTTTTTGGTATGCTCAATAA
GTGCGTCACTCCTATGGGAAAACATCTCTTGAGGACATGGTTTTTACGTCCTATAATCGA
TATTGATGTCATAAATAATCGCCTCAATACAATATCATTCTTTCTTTGCTGTGAAGATGT
AATGTCTGCACTGCGTGGGACTTTGAAGTCTGTCAGAGATATTCCCCACATGCTCAAGAA
ATTCAACTCTCCAAGTTCATTCTGTACAAGCAGTGACTGGCATGCATTTCTGAAGTGCAT
TTGCTCTCTTCTGCATATAAACAAGATTTTTGAAGTAGGAATATCAGAGCATTTGGCAAT
CAAATTACAACATATGAACATTGACTTGGTTGGAAAGGCCAATTCTTCCATTACAGAAGA
GCTGGATTATGTATCAGATCTGGTAGTTGGTGTGATTGATGTGCAACGGGGTAAAGAAAA
AGGCTACGACACACTGGTGAAAGACGGATTATGTGAGGAGTTAGACGAACTGAGGATGGT
CTATGAAGAATTGCCTGATTTTTTGGAGCAGGTGTCAGCCAATGAAATTGCCTCCTTCCC
TTTCTCATTTGAATGCAGAAAAGCTCCTCTAATCGTCTATGTACACCAAATAGGATATTT
AATGTGTTTTTTCGATGAGAAGATAAGTGATGCCTTGTTGATAGGACTTCCAGATTTTGA
ATTTGCGTTTTCTGAGGAAGGAGAGGAGAGAAGGTTCTACTATCATACTCAAAAGACGAG
AGAACTTGACAATCTTCTGGGCGATATTTACCATAAAATTCTTGACATGGAGAGAGCAAT
TATAAGGGATTTAGTGTGTCGTGTTTGCCAGTTTATACCTCAACTGACGAAAGCAGTAAA
CTTTGCAGCAGAACTTGATTGCATATTATCGTTGGCAATTGTTGCTCGCCAAAACAATTA
TGTGAGGCCCATCTTAACTGAGGATTCCATACTTGAGATACAGAATGGCAGACATGCTTT
GCAGGAAATGACTGTTGATACCTTCGTTCCAAATGACACTAAAATCCGCAGTTCAGGACG
AATCAACATAATAACTGGACCTAACTACTCAGGGAAAAGCATTTACATCAAGCAGGTGGC
TTTGGTGGTTTTTCTTGCTCATATTGGAAGCTTTGTTCCTGCTGATTCTGCCATTGTTGG
ATTGACAGATAGGATTTTCTGTGCAATGGGCAGCAAATCCATGACAAGTGAACAGTCAAC
TTTTATGATTGATTTACATCAAGTTGGAACAATGCTCAGGCACGCAACATCGAGATCCCT
ATGCTTATTGGATGAATTCGGAAAAGGCACTCTAACAGAAGATGGTATTGGTCTGCTTGG
AGGAACTATCAGCCATTTTACAGACTACGATTGTCCTCCAAAGGTCCTTTTGTCAACACA
TCTGACACAGATTTTCACAGAAAGCTACCTGCCGCAGTCTGAACATATCAAATGTTATAC
CATGAGTGTTCTGAATCCTGATGAACAAACAGACAACGAAGATGTCATATTCCTTTATCG
ACTTGTACCTGGGCAAGCGCTCTTGAGCTTTGGACTACACTGTGCACAGCTTGCTGGTGT
TCCGAGTGAAGTTGTTCAGAGAGCTGTTACTGTTTTGGGGGACATCCACTCAAAGAGACC
TATAAGGCGCATGGTCTGGGAGAAGTTAGCAGCAAAGGACCAACAATACCAGGATGCAGT
GACTAAACTGTTGGCCTTCGACCCACACAAAGGTGATCTGGTCAACTTCTTCCAGGAAGT
TTTTCCGTCCTAGCTGTAGACCAGGCTGCATGGAACCTACAAAACAAATGATGTAAAAGA
GTTGCTTAAAACATGGAATTGGCAGATCATACGCGACCTGCTCCAGGAACCTACAAAACA
AATGCTGAACCTCACTTGATCAGTGGCGTTGGGACATTGTGTACATATTTGCTTGGCAAT
GAGAAATCAAATTTTGCGTCTTTTCTGTTTGGATGAGACTTGTCATCGCCATTAAACGAA
TATTCTGTAGTTTCGT

CDS

2430 bp

>Os05t0498300-01 Rice homolog of MSH5, Meiosis-specific member of the MutS-homolog family, Control of class I crossover formation
ATGGACGAGGAAGAGGAGGAGGAGATGTCCGAGAGGGAGGTCGACTCCCAGGTTCATATG
GCTTGTGTAATGCAAGGACGCAGAGTTGGAATAGCATACTATGATTCAAGTATGCACCAG
CTTTTTGTATTGGAAATCTGGGAAGACATAACTGAAGATTTTCCTTTGATTGATCTTGTG
AAATATCAATCCAAACCGAGCACAATATACACAAGTACTAAAACAGATGAGGCACTTTTG
TTGGCGTTACAACGAAATGATTGTAATGATGAGGCCCCTGCTGTGAAGCTCATGAAAAGC
TCAACCTTCAGCTATGAGCAAGCCTGGCACAGATTAATGTACTTGAAAGTCGCAGCTATG
GACGAAGGGTTAAGTGTAAAAGAAAGGATCTGTTTTCTTAATTCCATGATGGATCTTGGA
AGTGACGTTCAAGTTCGTGCTGCTGGAGGTCTTCTTGCTATATTAGACAACGAGAGGCTT
CTTGATACCCTTGATCAGATGGAAGGTGGAGCATCCATTGCTATTGATTCTGTGGCACAG
ATATCATTGGACAAGTTCCTGAAACTTGATGCAACAGCTCACGAGGCGCTACAGATTTTT
CAAGTAGATAAACACCCCAGTTACATGGGAATTGGAAGGGCTAAAGAAGGGTTCTCAGTT
TTTGGTATGCTCAATAAGTGCGTCACTCCTATGGGAAAACATCTCTTGAGGACATGGTTT
TTACGTCCTATAATCGATATTGATGTCATAAATAATCGCCTCAATACAATATCATTCTTT
CTTTGCTGTGAAGATGTAATGTCTGCACTGCGTGGGACTTTGAAGTCTGTCAGAGATATT
CCCCACATGCTCAAGAAATTCAACTCTCCAAGTTCATTCTGTACAAGCAGTGACTGGCAT
GCATTTCTGAAGTGCATTTGCTCTCTTCTGCATATAAACAAGATTTTTGAAGTAGGAATA
TCAGAGCATTTGGCAATCAAATTACAACATATGAACATTGACTTGGTTGGAAAGGCCAAT
TCTTCCATTACAGAAGAGCTGGATTATGTATCAGATCTGGTAGTTGGTGTGATTGATGTG
CAACGGGGTAAAGAAAAAGGCTACGACACACTGGTGAAAGACGGATTATGTGAGGAGTTA
GACGAACTGAGGATGGTCTATGAAGAATTGCCTGATTTTTTGGAGCAGGTGTCAGCCAAT
GAAATTGCCTCCTTCCCTTTCTCATTTGAATGCAGAAAAGCTCCTCTAATCGTCTATGTA
CACCAAATAGGATATTTAATGTGTTTTTTCGATGAGAAGATAAGTGATGCCTTGTTGATA
GGACTTCCAGATTTTGAATTTGCGTTTTCTGAGGAAGGAGAGGAGAGAAGGTTCTACTAT
CATACTCAAAAGACGAGAGAACTTGACAATCTTCTGGGCGATATTTACCATAAAATTCTT
GACATGGAGAGAGCAATTATAAGGGATTTAGTGTGTCGTGTTTGCCAGTTTATACCTCAA
CTGACGAAAGCAGTAAACTTTGCAGCAGAACTTGATTGCATATTATCGTTGGCAATTGTT
GCTCGCCAAAACAATTATGTGAGGCCCATCTTAACTGAGGATTCCATACTTGAGATACAG
AATGGCAGACATGCTTTGCAGGAAATGACTGTTGATACCTTCGTTCCAAATGACACTAAA
ATCCGCAGTTCAGGACGAATCAACATAATAACTGGACCTAACTACTCAGGGAAAAGCATT
TACATCAAGCAGGTGGCTTTGGTGGTTTTTCTTGCTCATATTGGAAGCTTTGTTCCTGCT
GATTCTGCCATTGTTGGATTGACAGATAGGATTTTCTGTGCAATGGGCAGCAAATCCATG
ACAAGTGAACAGTCAACTTTTATGATTGATTTACATCAAGTTGGAACAATGCTCAGGCAC
GCAACATCGAGATCCCTATGCTTATTGGATGAATTCGGAAAAGGCACTCTAACAGAAGAT
GGTATTGGTCTGCTTGGAGGAACTATCAGCCATTTTACAGACTACGATTGTCCTCCAAAG
GTCCTTTTGTCAACACATCTGACACAGATTTTCACAGAAAGCTACCTGCCGCAGTCTGAA
CATATCAAATGTTATACCATGAGTGTTCTGAATCCTGATGAACAAACAGACAACGAAGAT
GTCATATTCCTTTATCGACTTGTACCTGGGCAAGCGCTCTTGAGCTTTGGACTACACTGT
GCACAGCTTGCTGGTGTTCCGAGTGAAGTTGTTCAGAGAGCTGTTACTGTTTTGGGGGAC
ATCCACTCAAAGAGACCTATAAGGCGCATGGTCTGGGAGAAGTTAGCAGCAAAGGACCAA
CAATACCAGGATGCAGTGACTAAACTGTTGGCCTTCGACCCACACAAAGGTGATCTGGTC
AACTTCTTCCAGGAAGTTTTTCCGTCCTAG

Protein

810 aa

>Os05t0498300-01 Rice homolog of MSH5, Meiosis-specific member of the MutS-homolog family, Control of class I crossover formation
MDEEEEEEMSEREVDSQVHMACVMQGRRVGIAYYDSSMHQLFVLEIWEDITEDFPLIDLV
KYQSKPSTIYTSTKTDEALLLALQRNDCNDEAPAVKLMKSSTFSYEQAWHRLMYLKVAAM
DEGLSVKERICFLNSMMDLGSDVQVRAAGGLLAILDNERLLDTLDQMEGGASIAIDSVAQ
ISLDKFLKLDATAHEALQIFQVDKHPSYMGIGRAKEGFSVFGMLNKCVTPMGKHLLRTWF
LRPIIDIDVINNRLNTISFFLCCEDVMSALRGTLKSVRDIPHMLKKFNSPSSFCTSSDWH
AFLKCICSLLHINKIFEVGISEHLAIKLQHMNIDLVGKANSSITEELDYVSDLVVGVIDV
QRGKEKGYDTLVKDGLCEELDELRMVYEELPDFLEQVSANEIASFPFSFECRKAPLIVYV
HQIGYLMCFFDEKISDALLIGLPDFEFAFSEEGEERRFYYHTQKTRELDNLLGDIYHKIL
DMERAIIRDLVCRVCQFIPQLTKAVNFAAELDCILSLAIVARQNNYVRPILTEDSILEIQ
NGRHALQEMTVDTFVPNDTKIRSSGRINIITGPNYSGKSIYIKQVALVVFLAHIGSFVPA
DSAIVGLTDRIFCAMGSKSMTSEQSTFMIDLHQVGTMLRHATSRSLCLLDEFGKGTLTED
GIGLLGGTISHFTDYDCPPKVLLSTHLTQIFTESYLPQSEHIKCYTMSVLNPDEQTDNED
VIFLYRLVPGQALLSFGLHCAQLAGVPSEVVQRAVTVLGDIHSKRPIRRMVWEKLAAKDQ
QYQDAVTKLLAFDPHKGDLVNFFQEVFPS*

5'UTR

chr05:24522895..24523177 (+ strand) : 283 bp

CDS

chr05:24523178..24523228 (+ strand) : 51 bp

chr05:24523790..24523821 (+ strand) : 32 bp

chr05:24523913..24524007 (+ strand) : 95 bp

chr05:24524201..24524281 (+ strand) : 81 bp

chr05:24524354..24524426 (+ strand) : 73 bp

chr05:24524993..24525056 (+ strand) : 64 bp

chr05:24525654..24525805 (+ strand) : 152 bp

chr05:24526043..24526144 (+ strand) : 102 bp

chr05:24526219..24526246 (+ strand) : 28 bp

chr05:24526321..24526352 (+ strand) : 32 bp

chr05:24526436..24526493 (+ strand) : 58 bp

chr05:24526594..24526680 (+ strand) : 87 bp

chr05:24527217..24527273 (+ strand) : 57 bp

chr05:24527491..24527592 (+ strand) : 102 bp

chr05:24527733..24527777 (+ strand) : 45 bp

chr05:24528805..24528882 (+ strand) : 78 bp

chr05:24529539..24529589 (+ strand) : 51 bp

chr05:24529664..24529745 (+ strand) : 82 bp

chr05:24530072..24530145 (+ strand) : 74 bp

chr05:24530213..24530309 (+ strand) : 97 bp

chr05:24530873..24530969 (+ strand) : 97 bp

chr05:24531062..24531151 (+ strand) : 90 bp

chr05:24531269..24531333 (+ strand) : 65 bp

chr05:24531419..24531477 (+ strand) : 59 bp

chr05:24531569..24531645 (+ strand) : 77 bp

chr05:24531881..24531967 (+ strand) : 87 bp

chr05:24532043..24532102 (+ strand) : 60 bp

chr05:24532198..24532261 (+ strand) : 64 bp

chr05:24533058..24533111 (+ strand) : 54 bp

chr05:24533216..24533298 (+ strand) : 83 bp

chr05:24533393..24533424 (+ strand) : 32 bp

chr05:24533503..24533526 (+ strand) : 24 bp

chr05:24533818..24533933 (+ strand) : 116 bp

chr05:24534012..24534092 (+ strand) : 81 bp

3'UTR

chr05:24534093..24534335 (+ strand) : 243 bp

FASTA

>Os05t0498300-01 class=Sequence position=chr05:24522895..24534335 (+ strand)
AACAACTTCC TTCCCGTACA AGCCAGTGCC CGAGCCACGC TCCCGCCGCA CTTCGCCCCT CGCCGCCTAG CTTGCTCCAT
CCTCCGCGCC CGCGCAGCTG CGCTCGCCGT CGCCGTCGCT GCCTAGCTTC CTCCAGCCTC CGCATCTGCG CTCTATTTGT
ACCGCATTCT CGGAGGAGGA GCAGGAGGCG AGGAGCCGCC GAGTAGAGGA GAGGGGGAGG CGAAGTCGGT GCTCTCGCCG
GGGGTTGACG GTGGAACTCC GGGCGAGCGA TCGAGCCGGC GAAATGGACG AGGAAGAGGA GGAGGAGATG TCCGAGAGGG
AGGTCGACTC CCAGGTGCGT ATTGGCCCGA TCCTTCCGAG TTCCTCGCCT CTTATTGCGC CACACGGAGT AGATTTCTCT
GCCCCCCCCT CCCCCACCCC GCTGCAATCC GATCGAATCG TGTTGCCGAA ACCCCAGTTC CGCGCGATGC CGGGTTCTAT
TTTATTTTAA ACGAAAATGT CGTGTTCTAG TCTGGAATGT AGCTTAGTAG TTGTAGACAT CAGCTGTACT GCTTTTACGG
CACCTTCCCG AGCGTCACAC ATTTTCCTTT TATCTGATGC GGATGCGGCG CCATGCTCAG ATTTGGTTCA GGTGATGCTT
AGGAAAGGCG AATCAAACAT TGCTAGTTTA GTTGATGATT TCTGTAATGT TGTTCATTGT ACAAGCCTCA AACCACCTTC
CGACCAGATG CACATTTTGA TATGCAAATG CATTCCTCTG TATTTCTCAT GATGAGACGA ATCGATGTAT TGAGTTTAAG
AGGAACAGCC GAACAGGTCC TATAGCTGTA GAAAATTTTG CACGTCTTTG TTCTAATGCA CTGTACGTAC TGAGTGTCAA
AGGATTACAT TTCAGGTTCA TATGGCTTGT GTAATGCAAG GACGCAGGTA AAATTTTGAT GCATACTTGA TTTGTTGAGT
CTGAGATACC ACTGTTTCTC TATCTAACAT TAATCCATGC TACTTTAATG ATTCTCAGAG TTGGAATAGC ATACTATGAT
TCAAGTATGC ACCAGCTTTT TGTATTGGAA ATCTGGGAAG ACATAACTGA AGATTTTCCT TTGATTGATC TTGGTATGGT
GCTCATATGA CCACACTTAT ACCAACTAAT TTCTCTATCT ATATGAAACG GAAATTTACT TGTAATATAA TGCATTTTTG
GTAACAAACA ATTTACATCA TGTCCACTGT CAACTATTTT GAACACTTCG AATAGAGGAA ACATGGTTAT ATAGCTGACA
ATCTGTGGTG TTTTTTGCTG TCACAGTGAA ATATCAATCC AAACCGAGCA CAATATACAC AAGTACTAAA ACAGATGAGG
CACTTTTGTT GGCGTTACAA CGAAATGGTT TGAACTGCAA CAATTTCTTT AACCAATATC TTCAGTTCTC CTTTAATGAT
TTTGGTTAAA ATCATTCAGA TTGTAATGAT GAGGCCCCTG CTGTGAAGCT CATGAAAAGC TCAACCTTCA GCTATGAGCA
AGCCTGGCAC AGGTTAGCAG CTCTGTTAAA GTGATACATG CGATTTCCAC ACCACATAAT ATGCTTTACC TGATTCGCAA
GAATTGATAG GACTTAATAC ACAAATGCTA AATTGTGTCG CATGTTGCAT CTGCATATGA AATCAACCAC ATTGATCAAG
TGAGCAATCA AAGCTAAATG TGCATGGTTT GGAAACTTCT AAAGTACtac ttcctccgtt ccacaatgta aaactttcta
gcattgccta gattcatata tatgttaatg aatctagata tatatagaaa acatatacat tgatcaatgg ataaatctag
gtaaggccaa aaagtcttac aatatgaaac agagggagta TTCATTAACA GAGGTGTTTG GTAACTTATG TTACATACCG
CGATCTTGTG ATGCATAGAT GTTGGCCGAT CCCTTTTCAA TGAGGAAACC AAGAATTATC AATTCCGGGA AAAATTCATT
ACAAGCAACA ACCTTGTAGG CTAATAGTAC CTTCACCTGT CAATCATTAT ATTTCTGATG ATGTGATGAT GAAATATCAT
TGTGTTTGTA AATTTCAGAT TAATGTACTT GAAAGTCGCA GCTATGGACG AAGGGTTAAG TGTAAAAGAA AGGATCTGTT
TTGTAAGTGA TTTAAGTGAG ATTGCCTCTA CTCGTTTGTA CTTATATGTT TTAGATCATC TACATTGGCA CGAGCTTAAG
CATTTATGAA TTATTGTTCA AACTACTGCT AAAGCCATAT ATTCCTTTTC TGACATTTCT TCATTGTCAC ATATAGCATG
CACAATTTAT GAATATTAGC ATATTGCCCA TGCGTTGCAA CAGAATTAAA AAAAATAACG TCATCAACCC GTTTTTCTAT
CACTTACATA TCTCATCTCT TAATTTCTGA TACACCTTTG AGCTGATAGG TGGAACCTTC GGACCCACAC TCTCATTTAC
GGTGAAGAAA GTACATGTCC ATTATGCTCA ATTGCATAGT TAGAAACAGA TCTTTTATCT TCATTGTAAT GAGCTGTTGA
GTAGCATTTT CTGTGTGAAG ATCTGTTTGC ATCTTCCACT GGACATCCTT TATTTGTCTC ACACAAGTTG CTGTTACACT
CTTTCTATTT CCTTTTCTAT CACTCGCCCT TCTGGCTCAA TTTTTTGTTT CTGTCACTCA GATTTGTCTT TCAAGTTTTG
TTATTATGCA GTGGTAATAA TTTTAGGATT TGTTTACAGC TTAATTCCAT GATGGATCTT GGAAGTGACG TTCAAGTTCG
TGCTGCTGGA GGTCTTCTTG CTATATTAGA CAACGAGAGG CTTCTTGATA CCCTTGATCA GATGGAAGGT GGAGCATCCA
TTGCTATTGA TTCTGTGGCA CAGATATCAT TTTATCCTTT TATCCGTAAT GATATTATAC GGACTAAATG TGCTAATGTA
CTGATCAGCA TGTTTTTGTG GTTTTACTTT GGAAACAAGT TAGAAAGCTA TTTATGTAGG ATTGTAGGTA CTCTTCAGGG
TAAAGTTATA TCTTGACAAT TTGTTGCATA GTGTTCGATG CATTCTTAAC AGGCTGGTAT TCTCATGTTT TTGTGTATTT
AGTATTATAT TCCTTGACAC GCTCTCAGGG ACAAGTTCCT GAAACTTGAT GCAACAGCTC ACGAGGCGCT ACAGATTTTT
CAAGTAGATA AACACCCCAG TTACATGGGA ATTGGAAGGG CTAAAGAAGG GTAAGGATTT TGTCTAAACC TTGTACTTTC
TCATAGCCAT GGTTCTGATT TGTAATAGTA ACAAAAAATT ACAGGTTCTC AGTTTTTGGT ATGCTCAATA AGGTAAATGA
GATATTTCTC TTCTATTCTT CGTTTCTACC AGTTTACTGA TTATGTTGTG GTCTTGTGGA TTGTAGTGCG TCACTCCTAT
GGGAAAACAT CTCTTGAGGT CACTGTTACT TTCTATAATC ATGATTGCAG ATTTGCAGTA AGAATGGCAT TCGTCTTAAC
TAATTTTATG CTTCATTCCA GGACATGGTT TTTACGTCCT ATAATCGATA TTGATGTCAT AAATAATCGC CTCAATACAG
TATCCTTAAT TTGTTGAATA CACATTTCTC AATTTCCCCA ATGCTCAATA CCAAAAAGGT ACCAGTAGAT TTCTGAACTG
TTTCTCCTAG ACATGCTAGA TATCATTCTT TCTTTGCTGT GAAGATGTAA TGTCTGCACT GCGTGGGACT TTGAAGTCTG
TCAGAGATAT TCCCCACATG CTCAAGGTGC TATTATCTTT ACTCTGTATG TTACTTGTAC CTCCTTTTCT TATCATTCCC
CATGTTATAA AAAGAGAGGT GTGCTGAAAT AAAGTAAACA AATGATAGTA TCTCACAGTC CTCTGTTGAA AAACAGAGGT
TAAACCTGCC TTTTGTGTTG AGTATGTTGG TGTTGCTTGT GTTTTACCCT TCACATAAAT GTATAAATTC TGTAGTTCTC
TTTTAGTATT TGGTCATTGC TCATGGCTTT GTTTTCTTGG ACTCGCACAC ATTGTGAGTT TTGTTCTCAA TGATATATAT
GTTGTCGTTG TTGTACATAT AAGAAGGAAC AAAGCCTTGC TTTTTTTAAG TTAGCAATTA TTCTATTTGA AGTAGAAGAG
ACTCAAGAGT AATGTTAACT GTGAAATAAT TGAATCAACG GATCATGATA ATTATATGCT TATCATAACA TGTCGTGGTT
ATTCTTATTC TCTTTGAGCA CACATTATTC TTCTTCACAG TTTTTCTAAT GTGCATAACT GACATTTTAT ATTTTTCTGA
AGAAATTCAA CTCTCCAAGT TCATTCTGTA CAAGCAGTGA CTGGCATGCA TTTCTGAAGG TACCTACCTG TAATGATGCA
TATGGATCTG GCTATTACTT TATAAATGCA CAATCACTTT GAATATGCTC CTGCGTTTTC CTTCTCCCAC TTAGCTATTC
CATATTTGAA GCTCTGCCCT AAGTGCAAGA TACGAAGCAC CCATACGTGC ATGATTTTCT TTTCTTTCAT TTCTCTTGCT
GATAATATCC CTTTTCTTTC ACTTCTCTTA TTTCAGTGCA TTTGCTCTCT TCTGCATATA AACAAGATTT TTGAAGTAGG
AATATCAGAG CATTTGGCAA TCAAATTACA ACATATGAAC ATTGACTTGG TTGGAAAGGT ATGCCTCCAA GTAGGGGCTA
TTAATTTTCA TCATCACTTA AATAATAGAA ATTTGGTACA ATAGTGTTAT TGCACATCCA TGAAACCTTA TTTTATAATA
ATGCTTTCTC CACATTCATG AAACTTTAAT GTTTTCAGGC CAATTCTTCC ATTACAGAAG AGCTGGATTA TGTATCAGAT
CTGGTCAGTT GCAACACAAT TGCATCTTAC TTGAAATGAA CAAGGAAATT CGGATACATT GTTTTGCCTT TAACTTAggg
cttgttcact ttgctaccat tttcaacctt accaagtttt ggcattgcca aattttggta agATAGCAGT CTAAACGTGT
CTCGaataac gtaccacatt ataccatgcc aaaatttggt aattttctag aatcttcaca tagctccaca caaaagaatt
ggtaaggcgc caaacctcta ccttaccatt ttttagcatt tgccaaactt taccaaaatt cggtaggatt tattttggga
tcaaagtgaa caggccttta gaATGTAGTG TGATAGATCA TTAGATCATT GGATACAACA ATACCAACAA TGGAACTTTT
GATTTATGTA GCCTGTGTTA GACCATATAG TTTTACTTGA CTGCTTGAGC TTATTCTCCT GATAGCTTGA TGAGACAATT
GTTAGCAGTG AATTATACAG ATGCATGTGC TCATCTCCTG GGTTTTTATC TCTAACGATG CAGCATACTG CAGTATGGAG
ATTATCACCA TAAAGTGTGG GCCTTGACTG TGTAGTGGAC TGATGCTTGA TAATATTAAG AGAGCATGAT TATTTGCAGG
TTTATTCTTT TGAAGTATTA AGATTAAAAA TTTGGCAGTG TTATGGAGGT CCTAGATGTA TTCATACTGG TATTGGTAGT
GAGCTACACG TTTCCATGCA AATATGCACA GTCCCGCTAG AGACCTGTTC CCATATTATT AGTTTGTCAG ATGCCATGTA
TGCAGTTTGC CACTTTGGTA TTGTCATCAA TATCTTCCTG ACTTAAATGG CTATTTCTGC AACTGGCAAC TTTTTCCAAG
GAATATTGAG CCTATGGGAC TTAATGCTGA TAATTCCAGA ACTTTTTCAC CGTAAAGGCG CATATTTATC TGGGCTTCTG
TGGAGCTTTA CTTAGCCCTT TTTCTTTCTC ATATATGAGG TCAATGGTTG TATACATCTG TTATCCATAG GTAGTTGGTG
TGATTGATGT GCAACGGGGT AAAGAAAAAG GCTACGACAC ACTGGTGAAA GACGGATTAT GTGAGGAGGT TGGACCTTGC
ACTTCTTTCT TTATGCCGGA GTCATGTTCT GTTCTTGAAT TACATTTTTA GGTTCTCGTT CCATGTAATT AAGCATCACT
TTAAAGGTAT TGTGAGGATT TGGGGGGGAG GGGGGGGCAG ACATCATCAG TACCAGCAAC TCCTGTTTAA AGTAATATAG
ATTTTGCCAT TATCATCCTC AGATGTTCCA GTTGTAGTTC TCACCATGGT GCTACTTTCT GCTGAGTGTA TTCCCTTGTT
CTCAAATGCT GTTTATCTAC CAATGGTTCT ACATATGAAA TTTTCAAACC TGGTTATGGA CTTATAGTTC AGTTGTTCAC
AGGGATCTAG TCATATTGGG GAGACCAGGC GCAGGTCATG GTTTGGAATT TGTACAATGC ACATGTTGGG TGTGGGAGAG
TGGGAGGGTG GTTGCATGCT TTCATCATTA TGGTTTTCCT AGCTGTTCGT CTATAACTAA TATTTAGTGC TTCGTATTAA
CTAGTAAATT TGAACTGTTT AGAAAAATAT TCGCCAGATT ATGTTTATTT TACTGCTATT AAATTATTGA ACTTGTTTGG
TTCTTCGAAA TGTCTACATT TTCCTGTTGC TATGATCATA ATTATAAAGG TTTGTCTAAA TTTATTTCTC TTAATGAAAA
ATAGTTAGAC GAACTGAGGA TGGTCTATGA AGAATTGCCT GATTTTTTGG AGCAGGTAAT GAATCTTCAG ACCCAAAAAT
TAATTTGAAT CCTTTATTTC ATAATTTCTA ATAACTTAGT TGTTTCTAGG TGTCAGCCAA TGAAATTGCC TCCTTCCCTT
TCTCATTTGA ATGCAGAAAA GCTCCTCTAA TCGTCTATGT ACACCAAATA GGTATCTTTT TCCCTCATCT GTTGCATTTT
CATACCGCCT TTTTCTTATT GTGCTATTTA ATTTGATATT ACCTACCTTT CTATATATGA TTTTAGCATG GATGTAGAAC
CAACTATCAT CACTACCACC TGAAATATAC TCCCTCTGTT TTTTTATTTG ACATTGATAG TTGTCAAGTA AAAGAAAATA
GAGGCAAAAG CTAGTTAGAA ATATGTAGCT GCTAAATAAT GATGGTAATG TTCAACATGC TCTTTTTGAG AAAAAAATCT
TGCATCTGAA CATTCGTATT CACCACTATT TATGTATTTC ATGCTTGCTG TTCCCAGGAT ATTTAATGTG TTTTTTCGAT
GAGAAGATAA GTGATGCCTT GTTGATAGGA CTTCCAGATT TTGAATTTGC GGTATGCGCT GTCTTATTTT TATTTTGGGT
TTAAGTTTTG AGTATGTAAT AATTTCCCTT TTTATCAGTT TTCTGAGGAA GGAGAGGAGA GAAGGTTCTA CTATCATACT
CAAAAGACGA GAGAACTTGA CAATCTTCTG GGCGATATTT ACCATAAAAT TCTTGGTAGT TTCATTCATT GATTTGTTTA
CTTCTTTTTT TTTCTGTCTT GCTGATGATG AAGACAAAAC CATCCTAATT TCTTCGAATG AATGTTGTGT GAACTTTCTT
TTTTGGGGGT AGTTTTAGGG TATTTTAACA GTTTACCTTC AATGTTACAG TCCGTGAATA AAAAGGCAGC TAGTACTTTA
CCTACAAACA GATCCTGTCA TACTCCAGTT ACACCCAAAA TGTTAATTGC AAAAGGATTT TTAGAATTAC TCCTATACTC
CAGTAATCAC CATATTTTCC ATAACTTGGT GTACTTTAAG AGGTAGATTG TACAGTTTTT ATCAAAGTTT AGTTGGCTTT
TTTCTTCTGT GCTCTATGGA CTGCTTCAGT TTGGTTGCAT AAGCCCGTTG GTATGTCATC AATCTCAAAT GACCTTCCGA
TGATATTAAT GCTTCATGAA ATATTAGTTA CTTGTCCAAA ATCATAATGT AGAATTTCTT AGAAAACACT CCCAAGTATT
TATTATCACT ATAGATGCAA TGGATTTTTT TTACTCTAAT GGGGTCATAT TGATACAGAC ATGGAGAGAG CAATTATAAG
GGATTTAGTG TGTCGTGTTT GCCAGTTTAT ACCTCAACTG ACGAAAGCAG TAAACTTTGC AGCAGAACTT GATTGGTATG
CGTGCAATTA TTGTGCATAT AGTGGTATTG TTCAACTTAG TTACTTCATG CTTATCTAAT GTGTTCTTAT TATTACCGTT
ACACCAGCAT ATTATCGTTG GCAATTGTTG CTCGCCAAAA CAATTATGTG AGGCCCATCT TAACTGAGGA TTCCATACTT
GAGATACAGA ATGGCAGGTT AGTATTTATC CACAGTATAC TCTCATGTTA CATCTTTGAT GGGTATTACT AACAGTGTAT
GGTTTAGATA TTTTTATCCA AAAGTTCGTA AACTTACTCC AGAATCAATT TTAGACATGC TTTGCAGGAA ATGACTGTTG
ATACCTTCGT TCCAAATGAC ACTAAAATCC GCAGTTCAGG TAATTAGTTC TCGTGAAATG TATACCAACA AGTTTACACT
GTAATAGTTT TGAACTTTCT GACTTAATAC TATTTTTATA CTAGGACGAA TCAACATAAT AACTGGACCT AACTACTCAG
GGAAAAGCAT TTACATCAAG CAGGTAATTT TGATATTGTG TATATTTCCT ACTGAAGCAT AAACCAGTGA ATTGCACGAC
AACGATCTAA CTATGTTGGA CATTTGCCTT CAAGGTGGCT TTGGTGGTTT TTCTTGCTCA TATTGGAAGC TTTGTTCCTG
CTGATTCTGC CATTGTTGGA TTGACAGATA GGTCTGTCTA TCACTTAAAA GCACACCGTC TATATGTCGC ATATGGCCTA
TGCTACAAAC TAGAAACTAG GAAACAATTG ATGTGTTAAT ATTCTTTGAC CAGATGCCAA TAATGTATCG ACTTGTTGAG
TATGCTGAAC AATGAATTAG AATCAAACAT TATCTGTTAT TAATACATAA TAGATAATAC TAGACTAACA CATGGCATCC
TTGACATTGC AAATAATGCT TTGCAGGATT TTCTGTGCAA TGGGCAGCAA ATCCATGACA AGTGAACAGT CAACTTTTAT
GATTGATTTA CATCAAGTTG GAACAATGCT CAGGTAAGAG TTAACACGGT AATCTCAACC TAAGGTTTTG TTGCCTCATG
ATATTGAACA TGCAGCTAAG TATTGCAGGC ACGCAACATC GAGATCCCTA TGCTTATTGG ATGAATTCGG AAAAGGCACT
CTAACAGAAG GCAAGAGTAC ATAAAATTTT AAATTCGCTG CCTTCCCCCT TCTAAATCCA TCACCACTGT AACAGTTGGG
GCTTTTCTTT TCTGATCCTT TCTAGATGGT ATTGGTCTGC TTGGAGGAAC TATCAGCCAT TTTACAGACT ACGATTGTCC
TCCAAAGGTG CTAGCTTGGA AAAATGTTGC TACTGAGCAT GAATGTGCTA TTTTTCTCCA TACTTCAATA AAAATAATAC
GCAGTTCTCC TGCATATTCT CGAAAAAGAA GTATAAATGT AAATGTGCTA GGGTTGCCTG CCTGATTCAT ACGTTATTAA
ACCTTTTCGT GGAGACTACT ATTATTTAAA CTCAAGCGGA TATGTATACA TCCAAGTATT GCTTGACTAG TATATTATAA
TTAGTTAAGA CTATAGGTTT ATTGAAATCA TACTAAATCA CTTAGGCTAT GTTactcacc tcccgcgcac gcaaaatgga
gcgacacatt ttcttatgat taattaagta tttattaatt tttcttgaaa aatggattaa tatgattttc taaagcaact
ttcgtataaa aactttttgc aaaaaAACGC ACCCGTGCGC GCGGAACACG AGGGAGGTGA GTTGGGAAAG GTGGGGGAAT
AACACAGCCT TAATACCCTT AAATGGTTAT TTTGCTCCAT ACTTCTACAA ATAACAATCA ACTTGACATT ACCTTCTCCA
AACATGAGGG AATGTGGTTT TACTTCCAAC CTGCATCATA TATGAAAAAA TCCTTGTGAT GATATTATGT TTTATTGAGT
AAAAGCAACA GTTATTGGCT CATTGCTCTT CTACATCTCA TAAATAGCTT ACTCAAACTT GGATATGCAA TAAGCCACTT
CTATTCAATA ATGCTACAAG AACCGACAAT TTGCAGTTTT AACATTTACC AGTGTATTAT GTTGGGATAT GGTACTCTTG
CAGGTCCTTT TGTCAACACA TCTGACACAG ATTTTCACAG AAAGCTACCT GCCGCAGGTA GCAAATATCT AGTTATTACT
GTGTAAAAGC AATTTATTTT ATTTTTTGTT GGATCCTTTT TTACCCTGTT CATAAAAAAA TTTTGACATG GAAATTTGCA
GTCTGAACAT ATCAAATGTT ATACCATGAG TGTTCTGAAT CCTGATGAAC AAACAGACAA CGAAGATGTC ATATTCCTTT
ATCGGTAAGT GGATATGGAA GCTGCTATGT ATTTCTCATA CCCATTATGT CATGTTTTGT ACTAATTTCT ATCTTAAATT
CTAATGCAAA CGTTGAAGAC TTGTACCTGG GCAAGCGCTC TTGAGCTTTG GTAAGCTTAT GCACTACATT TATACACATG
TACTCCATCT TTTCAAGTCA AATGCAACTA AAATTGATCT TCTCGCAGGA CTACACTGTG CACAGCTTGC TGGTATGTTC
AGAACAAACT GCGGTCAGCT GGCATTATGA TAACAGCGAT AAGTTACTCC GATTCTTTCC AAGGCAGACA TAAACTGCTG
AAATATCATG TTGATATAGT TACTGTCATT ATAATTCAGT AATTGACATG TTATGCAGTA AGAGTAGCAT CATTTTTACT
AAAAGTTCCT TCTGTAACAT GGAACGTGGA TGGTTCTAGG AGATATATAT AGTGAAACTA GATGGCATAT TACTCCAGAT
TGTCCACACG AATAGGATCA TCATGTTTCC AACTCTTTTA CAGGTGTTCC GAGTGAAGTT GTTCAGAGAG CTGTTACTGT
TTTGGGGGAC ATCCACTCAA AGAGACCTAT AAGGCGCATG GTCTGGGAGA AGTTAGCAGC AAAGGACCAA CAATACCAGG
TTATTATCCG CTGGTTTTAA ATGCAATATA GGCACGCGAA TCTGAAAGTG ATCTATTCTT TGTGTGAATA ATTTCAGGAT
GCAGTGACTA AACTGTTGGC CTTCGACCCA CACAAAGGTG ATCTGGTCAA CTTCTTCCAG GAAGTTTTTC CGTCCTAGCT
GTAGACCAGG CTGCATGGAA CCTACAAAAC AAATGATGTA AAAGAGTTGC TTAAAACATG GAATTGGCAG ATCATACGCG
ACCTGCTCCA GGAACCTACA AAACAAATGC TGAACCTCAC TTGATCAGTG GCGTTGGGAC ATTGTGTACA TATTTGCTTG
GCAATGAGAA ATCAAATTTT GCGTCTTTTC TGTTTGGATG AGACTTGTCA TCGCCATTAA ACGAATATTC TGTAGTTTCG
T

Locus: Os05g0498300

Loading...

Locus: Os05g0498300

Loading...