Os05t0510800-01

Locus

Os05g0510800

Description

Similar to Cellulose synthase-like family C1 protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CSLC7

CGSNL Gene Name

CELLULOSE SYNTHASE LIKE C7

Oryzabase Gene Symbol Synonym(s)

OsCslC7, OsCSLC7

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK243206 (DDBJ, Best hit)

Protein Evidence

C8CBX3 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Glycosyl transferase, family 2 (IPR001173)

Full-length cDNA

J100041K21 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0510800-01)

Others

Oryzabase (13894)

KEGG (Os05t0510800-01)

Transcript

2560 bp

>Os05t0510800-01 Similar to Cellulose synthase-like family C1 protein.
CTCCCGTACTACTAAGACCGACGTGGTGAGCTGTTCTTGTGCGCTCTGCTGCTGCCGCGG
GTGGCCGGCTGGCTTATTAAGGTTGAGGAGTTCTTGATGAGTAGGTGAGGCCGgaggagg
aggagcgattggttggttggttggttgattggagttgtgagaggttgtgttggcaatggc
gccgtcgtggtgggggaggagtggaggaggaggagtcggcaatgggggtggcacgccggt
ggtggtgaagatggagaatccgaactggtcaatctcggaggtggaggcggcggaggtggc
gccgggttcgccggcgggggcgggcaaggccgggcgcggcaagaacgcgcgccagatcac
gtgggtgctgctgctcaaggcgcaccgcgccgcggggcggctcacgggcgccgcgtccgc
cgcgctcgccgtcgcgtccgcggcgaggcgcagggtggcgtccgggcggaccgacgccga
cgccgcgccgggggagagcacggcgctgcgggcgcgctcctacggctgcatccgggtgtc
cctcgtcctgtctctgctgctgctcgccgtcgaggtcgccgcctacctccaggggtggca
cctcgaggaggtggcgtcgctcctcgccgtcgacggcctcttcgccgcctcctacgccgg
gtggatgcgcctccgcctcgactacctcgcgccgccgctccagttcctcaccaacgcctg
cgtcgccctcttcatggtccagagcatcgaccgcctcgtcctctgcctcggctgcttctg
gatcaggttcaagggcatcaagcccgtgccgcaggccgccgccgccggcaagccggacgt
cgaggctggcgccggcgactaccccatggtgctcgtccagatgcccatgtgcaacgagag
agaggtgtaccagcaatccattggggcagtttgcaacctggactggccaaagtcaaactt
cttggtgcaggtgttggacgattctgatgatgctaccacttctgcgctgatcaaggagga
ggtggagaaatggcagcgggagggcgtgcgcatcatataccggcaccgggtgatccggga
tggctacaaggctggaaaccttaaatcagccatgaattgcagttatgtgaaggattatga
gtttgttgtcatatttgatgccgatttccaaccacaagccgatttcctgaagcgaaccgt
gccacatttcaaggggaaggatgacgttgggttggttcaggcaagatggtctttcgtaaa
caaggatgagaacctgctgactagactacagaacgtaaatttgtgcttccactttgaggt
ggagcagcaggtgaatggtgcattcctcaacttctttggattcaatggaactgccggagt
ttggagaattaaggcgcttgaggattcggggggctggatggagagaacaacagtggagga
catggatattgctgtccgagcacatcttaagggatggaagtttgtcttcctgaatgatgt
tgagtgtcaatgtgagttgccagaatcatatgaagcgtacagaaagcagcaacacaggtg
gcactcaggtcccatgcaattgttcagactctgctttgtggacattataaaatctaagat
tgggttctggaagaagttcaacctcatattccttttcttcctcctccgcaagctcatcct
acccttctattcattcacacttttctgtgtcatccttcccatgacaatgtttgttcctga
agctgagctccctgcctgggttgtatgctacattccagctacaatgtccatcctgaacat
cctcccagccccaaaatctttcccattcattgtcccataccttcttttcgagaacactat
gtccgtaaccaagttcaatgccatgatttctggattgttccagctcgggagtgcctatga
gtgggttgtcaccaagaaatcaggtcgttcttcggagggcgatcttgttgggctagttga
gaaacactccaagcagcaaagagtaggatctgctcccaatcttgacgcgctaacaaagga
ggagtcgaatcctaaaaaggactccaagaagaagaagcacaataggatctacaggaagga
actggcactttccttcctcttgttaacggcagcagctcgcagtttgctatctgctcaggg
aatccatttctactttcttctgttccaaggggtctcattcttggttgttggtctcgacct
aattggtgagcaagtggagtgatagaagatgaagagtttaatggggttcttttttgtttg
aaagaaaacactttgcaagcatcaaagggctctttgtaaagggaagagtgatgcaaatgt
tcgatgcttacacatggaagctttgatccctattctaggggtcaagattcatcacatata
ctgaactgtggagatgtagatagatatagtttggattaagcctgtgggatgcttttattc
cttcaggcaattcttttgtaagaatcttttgtgcctagatgggttcttcttctctcttaa
caaactttaccttcaaatgaagataatacatgtttctacc

CDS

2067 bp

>Os05t0510800-01 Similar to Cellulose synthase-like family C1 protein.
atggcgccgtcgtggtgggggaggagtggaggaggaggagtcggcaatgggggtggcacg
ccggtggtggtgaagatggagaatccgaactggtcaatctcggaggtggaggcggcggag
gtggcgccgggttcgccggcgggggcgggcaaggccgggcgcggcaagaacgcgcgccag
atcacgtgggtgctgctgctcaaggcgcaccgcgccgcggggcggctcacgggcgccgcg
tccgccgcgctcgccgtcgcgtccgcggcgaggcgcagggtggcgtccgggcggaccgac
gccgacgccgcgccgggggagagcacggcgctgcgggcgcgctcctacggctgcatccgg
gtgtccctcgtcctgtctctgctgctgctcgccgtcgaggtcgccgcctacctccagggg
tggcacctcgaggaggtggcgtcgctcctcgccgtcgacggcctcttcgccgcctcctac
gccgggtggatgcgcctccgcctcgactacctcgcgccgccgctccagttcctcaccaac
gcctgcgtcgccctcttcatggtccagagcatcgaccgcctcgtcctctgcctcggctgc
ttctggatcaggttcaagggcatcaagcccgtgccgcaggccgccgccgccggcaagccg
gacgtcgaggctggcgccggcgactaccccatggtgctcgtccagatgcccatgtgcaac
gagagagaggtgtaccagcaatccattggggcagtttgcaacctggactggccaaagtca
aacttcttggtgcaggtgttggacgattctgatgatgctaccacttctgcgctgatcaag
gaggaggtggagaaatggcagcgggagggcgtgcgcatcatataccggcaccgggtgatc
cgggatggctacaaggctggaaaccttaaatcagccatgaattgcagttatgtgaaggat
tatgagtttgttgtcatatttgatgccgatttccaaccacaagccgatttcctgaagcga
accgtgccacatttcaaggggaaggatgacgttgggttggttcaggcaagatggtctttc
gtaaacaaggatgagaacctgctgactagactacagaacgtaaatttgtgcttccacttt
gaggtggagcagcaggtgaatggtgcattcctcaacttctttggattcaatggaactgcc
ggagtttggagaattaaggcgcttgaggattcggggggctggatggagagaacaacagtg
gaggacatggatattgctgtccgagcacatcttaagggatggaagtttgtcttcctgaat
gatgttgagtgtcaatgtgagttgccagaatcatatgaagcgtacagaaagcagcaacac
aggtggcactcaggtcccatgcaattgttcagactctgctttgtggacattataaaatct
aagattgggttctggaagaagttcaacctcatattccttttcttcctcctccgcaagctc
atcctacccttctattcattcacacttttctgtgtcatccttcccatgacaatgtttgtt
cctgaagctgagctccctgcctgggttgtatgctacattccagctacaatgtccatcctg
aacatcctcccagccccaaaatctttcccattcattgtcccataccttcttttcgagaac
actatgtccgtaaccaagttcaatgccatgatttctggattgttccagctcgggagtgcc
tatgagtgggttgtcaccaagaaatcaggtcgttcttcggagggcgatcttgttgggcta
gttgagaaacactccaagcagcaaagagtaggatctgctcccaatcttgacgcgctaaca
aaggaggagtcgaatcctaaaaaggactccaagaagaagaagcacaataggatctacagg
aaggaactggcactttccttcctcttgttaacggcagcagctcgcagtttgctatctgct
cagggaatccatttctactttcttctgttccaaggggtctcattcttggttgttggtctc
gacctaattggtgagcaagtggagtga

Protein

689 aa

>Os05t0510800-01 Similar to Cellulose synthase-like family C1 protein.
MAPSWWGRSGGGGVGNGGGTPVVVKMENPNWSISEVEAAEVAPGSPAGAGKAGRGKNARQ
ITWVLLLKAHRAAGRLTGAASAALAVASAARRRVASGRTDADAAPGESTALRARSYGCIR
VSLVLSLLLLAVEVAAYLQGWHLEEVASLLAVDGLFAASYAGWMRLRLDYLAPPLQFLTN
ACVALFMVQSIDRLVLCLGCFWIRFKGIKPVPQAAAAGKPDVEAGAGDYPMVLVQMPMCN
EREVYQQSIGAVCNLDWPKSNFLVQVLDDSDDATTSALIKEEVEKWQREGVRIIYRHRVI
RDGYKAGNLKSAMNCSYVKDYEFVVIFDADFQPQADFLKRTVPHFKGKDDVGLVQARWSF
VNKDENLLTRLQNVNLCFHFEVEQQVNGAFLNFFGFNGTAGVWRIKALEDSGGWMERTTV
EDMDIAVRAHLKGWKFVFLNDVECQCELPESYEAYRKQQHRWHSGPMQLFRLCFVDIIKS
KIGFWKKFNLIFLFFLLRKLILPFYSFTLFCVILPMTMFVPEAELPAWVVCYIPATMSIL
NILPAPKSFPFIVPYLLFENTMSVTKFNAMISGLFQLGSAYEWVVTKKSGRSSEGDLVGL
VEKHSKQQRVGSAPNLDALTKEESNPKKDSKKKKHNRIYRKELALSFLLLTAAARSLLSA
QGIHFYFLLFQGVSFLVVGLDLIGEQVE*

5'UTR

chr05:25304499..25304673 (- strand) : 175 bp

CDS

chr05:25303770..25304498 (- strand) : 729 bp

chr05:25302864..25303172 (- strand) : 309 bp

chr05:25302463..25302753 (- strand) : 291 bp

chr05:25302257..25302370 (- strand) : 114 bp

chr05:25301163..25301786 (- strand) : 624 bp

3'UTR

chr05:25300845..25301162 (- strand) : 318 bp

FASTA

>Os05t0510800-01 class=Sequence position=chr05:25300845..25304673 (- strand)
CTCCCGTACT ACTAAGACCG ACGTGGTGAG CTGTTCTTGT GCGCTCTGCT GCTGCCGCGG GTGGCCGGCT GGCTTATTAA
GGTTGAGGAG TTCTTGATGA GTAGGTGAGG CCGgaggagg aggagcgatt ggttggttgg ttggttgatt ggagttgtga
gaggttgtgt tggcaatggc gccgtcgtgg tgggggagga gtggaggagg aggagtcggc aatgggggtg gcacgccggt
ggtggtgaag atggagaatc cgaactggtc aatctcggag gtggaggcgg cggaggtggc gccgggttcg ccggcggggg
cgggcaaggc cgggcgcggc aagaacgcgc gccagatcac gtgggtgctg ctgctcaagg cgcaccgcgc cgcggggcgg
ctcacgggcg ccgcgtccgc cgcgctcgcc gtcgcgtccg cggcgaggcg cagggtggcg tccgggcgga ccgacgccga
cgccgcgccg ggggagagca cggcgctgcg ggcgcgctcc tacggctgca tccgggtgtc cctcgtcctg tctctgctgc
tgctcgccgt cgaggtcgcc gcctacctcc aggggtggca cctcgaggag gtggcgtcgc tcctcgccgt cgacggcctc
ttcgccgcct cctacgccgg gtggatgcgc ctccgcctcg actacctcgc gccgccgctc cagttcctca ccaacgcctg
cgtcgccctc ttcatggtcc agagcatcga ccgcctcgtc ctctgcctcg gctgcttctg gatcaggttc aagggcatca
agcccgtgcc gcaggccgcc gccgccggca agccggacgt cgaggctggc gccggcgact accccatggt gctcgtccag
atgcccatgt gcaacgagag agaggtaagc ccaaagcaaa gctccaatca tttgctccat tgccctctta agttggaatt
tcagattggc tgttcattct cttgctatat gtacatttgt atcttcctgg atcaaaatat tcgaattatt ttagctgcaa
ttgggattcg atcccttagt tctagttctc ctctgcgcga attcagcagg aggattctgc tgattttgtg tagactctgc
attagattgg tttggatctt tgacctgtgt tcctctttga cccggagatg ttctgcatta acaacaactt gggtggtttc
tgaagtttta agttgctgtg atcttgcttg ctcaatacac tataacaaga gcaaaaattt ggtgttttta aggttgaatt
ttgccgttgg gtgtcgtacc tttcaagcat acttattgcc ctgattctct gtctggatgt tgtcgtcaac cagaagacat
gctaattgaa catcaaactg ggcagcatag cgtactcctt ttaagactag agcgtgctac gcacaatttg gaaatctgag
gctcaattat ctgagaggct aggccaattc aattgattcc atttcatctg gatgtttgca ggtgtaccag caatccattg
gggcagtttg caacctggac tggccaaagt caaacttctt ggtgcaggtg ttggacgatt ctgatgatgc taccacttct
gcgctgatca aggaggaggt ggagaaatgg cagcgggagg gcgtgcgcat catataccgg caccgggtga tccgggatgg
ctacaaggct ggaaacctta aatcagccat gaattgcagt tatgtgaagg attatgagtt tgttgtcata tttgatgccg
atttccaacc acaagccgat ttcctgaagc gaaccgtgcc acatttcaag gttggactca actgaacaat gctggcagtt
gtaaacacgt tgttgctttg cttctatgac tatgaaccgt attagttata ttttctgaca tcttgaatgt tgaattccag
gggaaggatg acgttgggtt ggttcaggca agatggtctt tcgtaaacaa ggatgagaac ctgctgacta gactacagaa
cgtaaatttg tgcttccact ttgaggtgga gcagcaggtg aatggtgcat tcctcaactt ctttggattc aatggaactg
ccggagtttg gagaattaag gcgcttgagg attcgggggg ctggatggag agaacaacag tggaggacat ggatattgct
gtccgagcac atcttaaggg atggaagttt gtcttcctga atgatgttga ggtacaatca ataatttctt cgtggcttaa
gcagaatctg cattgtataa atgtcaaaga ctaataattt gattcatgtg atttcccttg cagtgtcaat gtgagttgcc
agaatcatat gaagcgtaca gaaagcagca acacaggtgg cactcaggtc ccatgcaatt gttcagactc tgctttgtgg
acattataaa atctaaggta cgatactttt cttctgtagc actgtgaaag ctaaaatttc cagcaatgca tgtactagca
tagcctgtaa ctgtagtttc tttgctagag tcactttccc aatatgttat gggtttaatg agaatttaca agatggagta
gttgttgaga agcatcaacc atggtacctt tttacatgtt tgggcaaact ttatgcatat tatcttatat tgaggcacaa
tataagaaaa ttgaacaaga tgatgagttg ctaaccactc aagcaagtta ccaatgtcca taagaattct ctgtcggttc
acttgattga aatcatcaaa gaacttatca caatctcgta ccaggacata tactaattaa gtttttttta tcccttcttc
atatttgatt tctacctatt agtccacagt ttttatactg tttcattgga taattaacct aatatcgctg cctaatttct
tgtgcagatt gggttctgga agaagttcaa cctcatattc cttttcttcc tcctccgcaa gctcatccta cccttctatt
cattcacact tttctgtgtc atccttccca tgacaatgtt tgttcctgaa gctgagctcc ctgcctgggt tgtatgctac
attccagcta caatgtccat cctgaacatc ctcccagccc caaaatcttt cccattcatt gtcccatacc ttcttttcga
gaacactatg tccgtaacca agttcaatgc catgatttct ggattgttcc agctcgggag tgcctatgag tgggttgtca
ccaagaaatc aggtcgttct tcggagggcg atcttgttgg gctagttgag aaacactcca agcagcaaag agtaggatct
gctcccaatc ttgacgcgct aacaaaggag gagtcgaatc ctaaaaagga ctccaagaag aagaagcaca ataggatcta
caggaaggaa ctggcacttt ccttcctctt gttaacggca gcagctcgca gtttgctatc tgctcaggga atccatttct
actttcttct gttccaaggg gtctcattct tggttgttgg tctcgaccta attggtgagc aagtggagtg atagaagatg
aagagtttaa tggggttctt ttttgtttga aagaaaacac tttgcaagca tcaaagggct ctttgtaaag ggaagagtga
tgcaaatgtt cgatgcttac acatggaagc tttgatccct attctagggg tcaagattca tcacatatac tgaactgtgg
agatgtagat agatatagtt tggattaagc ctgtgggatg cttttattcc ttcaggcaat tcttttgtaa gaatcttttg
tgcctagatg ggttcttctt ctctcttaac aaactttacc ttcaaatgaa gataatacat gtttctacc

Locus: Os05g0510800

Loading...

Locus: Os05g0510800

Loading...