Os05t0513800-01

Locus

Os05g0513800

Description

Small GTP-binding protein OsRac2.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

RAC2

CGSNL Gene Name

RAC/ROP-TYPE GTPASE 2

Oryzabase Gene Symbol Synonym(s)

OsRAC2, OsRac2

Oryzabase Gene Name Synonym(s)

Rac-like GTP-binding protein 2, Rac/Rop-type GTPase 2

Transcript Evidence

AK101866 (DDBJ, Best hit)

Protein Evidence

Q68Y52 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: GTP catabolic process (GO:0006184)

Biological Process: intracellular protein transport (GO:0006886)

Biological Process: nucleocytoplasmic transport (GO:0006913)

Biological Process: signal transduction (GO:0007165)

Biological Process: small GTPase mediated signal transduction (GO:0007264)

Biological Process: protein transport (GO:0015031)

Cellular Component: intracellular (GO:0005622)

Cellular Component: membrane (GO:0016020)

Molecular Function: GTPase activity (GO:0003924)

Molecular Function: GTP binding (GO:0005525)

Functional domain (InterPro)

Small GTPase superfamily (IPR001806)

Ran GTPase (IPR002041)

Small GTPase superfamily, Rho type (IPR003578)

Small GTPase superfamily, Rab type (IPR003579)

Small GTP-binding protein domain (IPR005225)

Small GTPase superfamily, Ras type (IPR020849)

Full-length cDNA

J033070C18 (Online Clone Ordering)

Expression Databases

TENOR (Os05t0513800-01)

RiceXPro (AK101866)

Others

Oryzabase (6766)

KEGG (Os05t0513800-01)

Transcript

1148 bp

>Os05t0513800-01 Small GTP-binding protein OsRac2.
AGTAGACCACCGGCATTTACACCCCGCAACACCCCCCCTCATCTCGCCGAACCCACGTCT
TTTAATAACAAAGCAGCTTGCCACCGTCCCTGCCTCTCCTGCTTTGCTTTGCCTTCTCGG
AGAAGACAAATCTACTGTAGCTGCTTGTCTCTGTTCGCCGGTGGCGACCGTGAGAGGAGG
AGGTAGTCCTAGTCCTAGTAGGCGAGATGAGCGGCGCCACCAAGTTCATCAAGTGCGTCA
CCGTCGGCGACGGCGCCGTCGGCAAGACCTGCATGCTCATCTGCTACACCAGCAACAAGT
TCCCCACCGATTACATCCCCACCGTGTTCGACAACTTCAGTGCTAATGTTTCAGTGGATG
GGAACATCGTCAACTTGGGATTATGGGACACTGCTGGACAAGAGGATTACAGCAGGCTGA
GGCCACTGAGCTACAGGGGAGCGGATATATTTGTGCTGGCATTCTCACTGATCAGCAGAG
CAAGCTATGAGAATGTTCTCAAGAAGTGGATGCCGGAGCTTCGCCGGTTCGCACCGAATG
TTCCAATTGTTCTTGTTGGGACCAAGTTAGATCTACGTGACCACAGATCTTACCTTGCGG
ACCATCCTGCTGCTTCCGCAATTACGACTGCACAGGGTGAAGAACTTAGAAAGCAGATAG
GCGCCGCGGCTTACATCGAATGCAGTTCGAAAACACAACAGAACATCAAGGCCGTGTTTG
ATACTGCCATCAAGGTGGTCCTTCAGCCTCCTCGGAGAAGGGGGGAGACGACGATGGCAA
GGAAGAAGACAAGGCGAAGCACCGGCTGCTCGTTAAAGAACTTGATGTGTGGCAGTGCAT
GTGTTGTTTAGGACCTGTCTGAATTCTTGAAGGTGTGTAAGCGTTGTGTAATGGCAAGTG
AATTTGCTGACTGTTCTGCTGCTTCCATTTACTACTACTAAGCTCTTTCGTGTGTTTGAA
TTACTACATCTAGAACTAGAGCATCAGGCTCATAGACTGACTTCATATCAGGTGTTTGTA
TCATTAATATTATTATGTAAGAAGGTTGTGGTTTGTGGAACAACTAAATACAACAATGCA
GGCTATGTTGTAGTATGCTCTGCTACTGGTGTATGTTATAAATATAAAATTCTGCTACAT
ACTTTTGT

CDS

645 bp

>Os05t0513800-01 Small GTP-binding protein OsRac2.
ATGAGCGGCGCCACCAAGTTCATCAAGTGCGTCACCGTCGGCGACGGCGCCGTCGGCAAG
ACCTGCATGCTCATCTGCTACACCAGCAACAAGTTCCCCACCGATTACATCCCCACCGTG
TTCGACAACTTCAGTGCTAATGTTTCAGTGGATGGGAACATCGTCAACTTGGGATTATGG
GACACTGCTGGACAAGAGGATTACAGCAGGCTGAGGCCACTGAGCTACAGGGGAGCGGAT
ATATTTGTGCTGGCATTCTCACTGATCAGCAGAGCAAGCTATGAGAATGTTCTCAAGAAG
TGGATGCCGGAGCTTCGCCGGTTCGCACCGAATGTTCCAATTGTTCTTGTTGGGACCAAG
TTAGATCTACGTGACCACAGATCTTACCTTGCGGACCATCCTGCTGCTTCCGCAATTACG
ACTGCACAGGGTGAAGAACTTAGAAAGCAGATAGGCGCCGCGGCTTACATCGAATGCAGT
TCGAAAACACAACAGAACATCAAGGCCGTGTTTGATACTGCCATCAAGGTGGTCCTTCAG
CCTCCTCGGAGAAGGGGGGAGACGACGATGGCAAGGAAGAAGACAAGGCGAAGCACCGGC
TGCTCGTTAAAGAACTTGATGTGTGGCAGTGCATGTGTTGTTTAG

Protein

215 aa

>Os05t0513800-01 Small GTP-binding protein OsRac2.
MSGATKFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVSVDGNIVNLGLW
DTAGQEDYSRLRPLSYRGADIFVLAFSLISRASYENVLKKWMPELRRFAPNVPIVLVGTK
LDLRDHRSYLADHPAASAITTAQGEELRKQIGAAAYIECSSKTQQNIKAVFDTAIKVVLQ
PPRRRGETTMARKKTRRSTGCSLKNLMCGSACVV*

5'UTR

chr05:25474799..25475004 (+ strand) : 206 bp

CDS

chr05:25475005..25475106 (+ strand) : 102 bp

chr05:25475294..25475381 (+ strand) : 88 bp

chr05:25475498..25475607 (+ strand) : 110 bp

chr05:25475854..25475917 (+ strand) : 64 bp

chr05:25476025..25476089 (+ strand) : 65 bp

chr05:25476176..25476241 (+ strand) : 66 bp

chr05:25476396..25476511 (+ strand) : 116 bp

chr05:25476694..25476727 (+ strand) : 34 bp

3'UTR

chr05:25476728..25477024 (+ strand) : 297 bp

FASTA

>Os05t0513800-01 class=Sequence position=chr05:25474799..25477024 (+ strand)
AGTAGACCAC CGGCATTTAC ACCCCGCAAC ACCCCCCCTC ATCTCGCCGA ACCCACGTCT TTTAATAACA AAGCAGCTTG
CCACCGTCCC TGCCTCTCCT GCTTTGCTTT GCCTTCTCGG AGAAGACAAA TCTACTGTAG CTGCTTGTCT CTGTTCGCCG
GTGGCGACCG TGAGAGGAGG AGGTAGTCCT AGTCCTAGTA GGCGAGATGA GCGGCGCCAC CAAGTTCATC AAGTGCGTCA
CCGTCGGCGA CGGCGCCGTC GGCAAGACCT GCATGCTCAT CTGCTACACC AGCAACAAGT TCCCCACCGT ATGTTCTCCC
CTCTCTCGCC GTTGTTCTTG CTGCTGTCCA TGGTTTTGCT CCTCTTTGTT TGTAATCAGA GAGAGAGAGA GAGAGAGAGA
GAGAGAAAAG ATGTACGCCT GTACTAGTCT TGCAATGTTC AGTGTTTGTG TGCATTTCTT GGTAGCGTTT GTGATGCTGT
TTCTTGGCTA TGCAGGATTA CATCCCCACC GTGTTCGACA ACTTCAGTGC TAATGTTTCA GTGGATGGGA ACATCGTCAA
CTTGGGATTA TGGGACACTG CTGGTAAAAC TGATTCTTCC ATTGCTCTAC TCTCTTCTGC TGAGATTTTC CTTTTTTTTT
ATCCCTGCAA CTGTCCAATC TCTGAACCTC TTGTGTGTTC TTTTGGTTGA TTCATCCAGG ACAAGAGGAT TACAGCAGGC
TGAGGCCACT GAGCTACAGG GGAGCGGATA TATTTGTGCT GGCATTCTCA CTGATCAGCA GAGCAAGCTA TGAGAATGTT
CTCAAGAAGG TAGGTACTAT ACTCCATTTA GTTCAGTTTG GACTCAAAAT GTCTGAACAT CTGACAACAT GAGGATAGTG
ACCACAGATA CTGTACCAAG AACTTTACCT TTCCTTCTGA CAATGACATT TTTAGACCAC CTTTGACCAA TATTCTTCAC
ATTTTTCTTC TTTACAGATA TATACTATAT GTGCATATGA TTTTCACTGG AATATTCTGA GCTAATGTTA TCTTTTTCTG
TTTCTGATCA TGCAGTGGAT GCCGGAGCTT CGCCGGTTCG CACCGAATGT TCCAATTGTT CTTGTTGGGA CCAAGTTAGG
TTTGTACCGG ATGCAACATT AACTCAACAA AGCTCAGTGC CACTTCCTTT TGCAGGCTTG TTTCAATGCT CTTAGGTTTT
AACCGTGCTT GCTTCCAATT GTTCAGATCT ACGTGACCAC AGATCTTACC TTGCGGACCA TCCTGCTGCT TCCGCAATTA
CGACTGCACA GGTTTGTTCT TTTATTTACC GAATCTTCTG TTCAGCATGA AAACACATTT ATTGGCGAAT TCGATGACCG
TATAAGTTTA TGTTCAGGGT GAAGAACTTA GAAAGCAGAT AGGCGCCGCG GCTTACATCG AATGCAGTTC GAAAACACAA
CAGGTACAAA ACTGCAAACA ATGGATTCAA TCGATTAGTT CTTTGTCATA GTTTGAAGAG TTCCTTGCTA TATATATACT
GTAGCAATTC AAGTTGGACA GACTGTTGCT TTAATGAACC ATTTATGTTG AGCTGATAAT GTTGTTGGCC ATGGTAGAAC
ATCAAGGCCG TGTTTGATAC TGCCATCAAG GTGGTCCTTC AGCCTCCTCG GAGAAGGGGG GAGACGACGA TGGCAAGGAA
GAAGACAAGG CGAAGCACCG GCTGCTCGTT AAAGTAAGAG CACACCTCAA AAGCCTTAGA ATTACATGGT TGGATCTTGT
GAGTTGTGAT CATGGACTAG CTATTATAAT GTTTGTGCCT AGTAAACATG AGTGCGCATC ATTTTCTACT TTGTGAATGA
AATAGTATGA ATTATGCAAT GGCTGATGTA ACTGTTTTTT TTTTTTTTAC TGCAGGAACT TGATGTGTGG CAGTGCATGT
GTTGTTTAGG ACCTGTCTGA ATTCTTGAAG GTGTGTAAGC GTTGTGTAAT GGCAAGTGAA TTTGCTGACT GTTCTGCTGC
TTCCATTTAC TACTACTAAG CTCTTTCGTG TGTTTGAATT ACTACATCTA GAACTAGAGC ATCAGGCTCA TAGACTGACT
TCATATCAGG TGTTTGTATC ATTAATATTA TTATGTAAGA AGGTTGTGGT TTGTGGAACA ACTAAATACA ACAATGCAGG
CTATGTTGTA GTATGCTCTG CTACTGGTGT ATGTTATAAA TATAAAATTC TGCTACATAC TTTTGT

Locus: Os05g0513800

Loading...

Locus: Os05g0513800

Loading...